• Gene id: 114770

Gene Summary

• Gene Symbol: PGLYRP2   Gene   UCSC   Ensembl
• Aliases: HMFT0141, PGLYRPL, PGRP-L, PGRPL, TAGL-like, tagL, tagL-alpha, tagl-beta
• Gene name: peptidoglycan recognition protein 2
• Alternate names: N-acetylmuramoyl-L-alanine amidase, peptidoglycan recognition protein L, peptidoglycan recognition protein long,
• Gene location: 19p13.12 (15479500: 15468644)     Exons: 5     NC_000019.10
• Gene summary(Entrez): This gene encodes a peptidoglycan recognition protein, which belongs to the N-acetylmuramoyl-L-alanine amidase 2 family. This protein hydrolyzes the link between N-acetylmuramoyl residues and L-amino acid residues in bacterial cell wall glycopeptides, and

Protein Summary

• Protein general information: Q96PD5  
  • Name: N acetylmuramoyl L alanine amidase (EC 3.5.1.28) (Peptidoglycan recognition protein 2) (Peptidoglycan recognition protein long) (PGRP L)
  • Length: 576  
  • Mass: 62217
  • Tissue specificity: Strongly expressed in liver and fetal liver, and secreted into serum. Expressed to a much lesser extent in transverse colon, lymph nodes, heart, thymus, pancreas, descending colon, stomach and testis. Isoform 2 is not detected in the l
• Sequence:

  MAQGVLWILLGLLLWSDPGTASLPLLMDSVIQALAELEQKVPAAKTRHTASAWLMSAPNSGPHNRLYHFLLGAWS
  LNATELDPCPLSPELLGLTKEVARHDVREGKEYGVVLAPDGSTVAVEPLLAGLEAGLQGRRVINLPLDSMAAPWE
  TGDTFPDVVAIAPDVRATSSPGLRDGSPDVTTADIGANTPDATKGCPDVQASLPDAKAKSPPTMVDSLLAVTLAG
  NLGLTFLRGSQTQSHPDLGTEGCWDQLSAPRTFTLLDPKASLLTMAFLNGALDGVILGDYLSRTPEPRPSLSHLL
  SQYYGAGVARDPGFRSNFRRQNGAALTSASILAQQVWGTLVLLQRLEPVHLQLQCMSQEQLAQVAANATKEFTEA
  FLGCPAIHPRCRWGAAPYRGRPKLLQLPLGFLYVHHTYVPAPPCTDFTRCAANMRSMQRYHQDTQGWGDIGYSFV
  VGSDGYVYEGRGWHWVGAHTLGHNSRGFGVAIVGNYTAALPTEAALRTVRDTLPSCAVRAGLLRPDYALLGHRQL
  VRTDCPGDALFDLLRTWPHFTATVKPRPARSVSKRSRREPPPRTLPATDLQ

• Structural information:
  • Protein Domains: (406..53-)
    (/note="N-acetylmuramoyl-L-alanine-amidase)
    (/evidence="ECO:0000255"-)
  • Interpro: IPR036505  IPR002502  IPR015510  IPR006619  
  • CDD: cd06583
  • STRING: ENSP00000345968
• Other Databases: GeneCards:  PGLYRP2  Malacards:  PGLYRP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008745	N-acetylmuramoyl-L-alanine amidase activity	IDA	molecular function
GO:0050830	defense response to Gram-positive bacterium	IBA	biological process
GO:0016045	detection of bacterium	IBA	biological process
GO:0042834	peptidoglycan binding	IBA	molecular function
GO:0016019	peptidoglycan immune receptor activity	IBA	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0008745	N-acetylmuramoyl-L-alanine amidase activity	IEA	molecular function
GO:0009253	peptidoglycan catabolic process	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0008745	N-acetylmuramoyl-L-alanine amidase activity	IEA	molecular function
GO:0019730	antimicrobial humoral response	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0050727	regulation of inflammatory response	IEA	biological process
GO:0032689	negative regulation of interferon-gamma production	IEA	biological process
GO:0032827	negative regulation of natural killer cell differentiation involved in immune response	IEA	biological process
GO:0044117	growth of symbiont in host	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0042834	peptidoglycan binding	IDA	molecular function
GO:0016019	peptidoglycan immune receptor activity	IDA	molecular function
GO:0050830	defense response to Gram-positive bacterium	IDA	biological process
GO:0016045	detection of bacterium	IDA	biological process
GO:0016020	membrane	NAS	cellular component
GO:0001519	peptide amidation	NAS	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0045087	innate immune response	NAS	biological process
GO:0008745	N-acetylmuramoyl-L-alanine amidase activity	TAS	molecular function
GO:0008745	N-acetylmuramoyl-L-alanine amidase activity	IDA	molecular function
GO:0050830	defense response to Gram-positive bacterium	IBA	biological process
GO:0016045	detection of bacterium	IBA	biological process
GO:0042834	peptidoglycan binding	IBA	molecular function
GO:0016019	peptidoglycan immune receptor activity	IBA	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0008745	N-acetylmuramoyl-L-alanine amidase activity	IEA	molecular function
GO:0009253	peptidoglycan catabolic process	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0008745	N-acetylmuramoyl-L-alanine amidase activity	IEA	molecular function
GO:0019730	antimicrobial humoral response	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0050727	regulation of inflammatory response	IEA	biological process
GO:0032689	negative regulation of interferon-gamma production	IEA	biological process
GO:0032827	negative regulation of natural killer cell differentiation involved in immune response	IEA	biological process
GO:0044117	growth of symbiont in host	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0042834	peptidoglycan binding	IDA	molecular function
GO:0016019	peptidoglycan immune receptor activity	IDA	molecular function
GO:0050830	defense response to Gram-positive bacterium	IDA	biological process
GO:0016045	detection of bacterium	IDA	biological process
GO:0016020	membrane	NAS	cellular component
GO:0001519	peptide amidation	NAS	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0045087	innate immune response	NAS	biological process
GO:0008745	N-acetylmuramoyl-L-alanine amidase activity	TAS	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq