• Gene id: 114769

Gene Summary

• Gene Symbol: CARD16   Gene   UCSC   Ensembl
• Aliases: COP, COP1, PSEUDO-ICE
• Gene name: caspase recruitment domain family member 16
• Alternate names: caspase recruitment domain-containing protein 16, CARD only domain-containing protein 1, CARD only protein, CARD-only protein 1, caspase recruitment domain-only protein 1, caspase-1 dominant-negative inhibitor pseudo-ICE, caspase-1 inhibitor COP, pseudo interleu,
• Gene location: 11q22.3 (105045415: 105040217)     Exons: 4     NC_000011.10
• OMIM: 615680

Protein Summary

• Protein general information: Q5EG05  
  • Name: Caspase recruitment domain containing protein 16 (Caspase recruitment domain only protein 1) (CARD only protein 1) (Caspase 1 inhibitor COP) (Pseudo interleukin 1 beta converting enzyme) (Pseudo ICE) (Pseudo IL1B converting enzyme)
  • Length: 197  
  • Mass: 22625
  • Tissue specificity: Widely expressed. Expressed at higher level in placenta, spleen, lymph node and bone marrow. Weakly or not expressed in thymus. {ECO
• Sequence:

  MADKVLKEKRKLFIHSMGEGTINGLLDELLQTRVLNQEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITY
  ICEEDSYLAETLGLSAALQAVQDNPAMPTCSSPEGRIKLCFLEDAQRIWKQKLQRCHVQNTIIKWSERYTSGSFE
  MQWLFLRTNFIERFWRNILLLPLHKGSLYPRIPGLGKELQTGTHKLS

• Structural information:
  • Protein Domains: (1..9-)
    (/note="CARD-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00046"-)
  • Interpro: IPR001315  IPR011029  
  • Prosite: PS50209
  • STRING: ENSP00000364858
• Other Databases: GeneCards:  CARD16  Malacards:  CARD16

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050713	negative regulation of interleukin-1 beta secretion	IBA	biological process
GO:0089720	caspase binding	IBA	molecular function
GO:0032991	protein-containing complex	IBA	cellular component
GO:0042981	regulation of apoptotic process	IEA	biological process
GO:0010466	negative regulation of peptidase activity	IEA	biological process
GO:0030414	peptidase inhibitor activity	IEA	molecular function
GO:0004869	cysteine-type endopeptidase inhibitor activity	IEA	molecular function
GO:0097179	protease inhibitor complex	IDA	cellular component
GO:0042802	identical protein binding	IDA	molecular function
GO:0050713	negative regulation of interleukin-1 beta secretion	IDA	biological process
GO:0050713	negative regulation of interleukin-1 beta secretion	IDA	biological process
GO:0050713	negative regulation of interleukin-1 beta secretion	IDA	biological process
GO:0043154	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	biological process
GO:0004869	cysteine-type endopeptidase inhibitor activity	IDA	molecular function
GO:0097340	inhibition of cysteine-type endopeptidase activity	IDA	biological process
GO:0050713	negative regulation of interleukin-1 beta secretion	IDA	biological process
GO:0032991	protein-containing complex	IDA	cellular component
GO:0071494	cellular response to UV-C	IDA	biological process
GO:0032991	protein-containing complex	IDA	cellular component
GO:0032091	negative regulation of protein binding	IDA	biological process
GO:0071222	cellular response to lipopolysaccharide	IDA	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IDA	biological process
GO:0032991	protein-containing complex	IDA	cellular component
GO:0071456	cellular response to hypoxia	IDA	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IDA	biological process
GO:0032091	negative regulation of protein binding	IDA	biological process
GO:0031665	negative regulation of lipopolysaccharide-mediated signaling pathway	IDA	biological process
GO:0032991	protein-containing complex	IDA	cellular component
GO:0019900	kinase binding	IPI	molecular function
GO:0019900	kinase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0089720	caspase binding	IPI	molecular function
GO:0089720	caspase binding	IPI	molecular function
GO:0010804	negative regulation of tumor necrosis factor-mediated signaling pathway	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0019900	kinase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0089720	caspase binding	IPI	molecular function
GO:0089720	caspase binding	IPI	molecular function
GO:0050700	CARD domain binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04621	NOD-like receptor signaling pathway

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R