• Gene id: 114757

Gene Summary

• Gene Symbol: CYGB   Gene   UCSC   Ensembl
• Aliases: HGB, STAP
• Gene name: cytoglobin
• Alternate names: cytoglobin, histoglobin, stellate cell activation-associated protein,
• Gene location: 17q25.1 (76557691: 76527355)     Exons: 7     NC_000017.11
• Gene summary(Entrez): This gene encodes a globin protein found in vertebrate cells. The encoded protein is described as a hexacoordinate hemoglobin which binds ligand differently from the pentacoordinate hemoglobins involved in oxygen transport, and may be involved in protecti
• OMIM: 611237

Protein Summary

• Protein general information: Q8WWM9  
  • Name: Cytoglobin (Histoglobin) (HGb) (Stellate cell activation associated protein)
  • Length: 190  
  • Mass: 21405
  • Tissue specificity: Ubiquitously expressed. Highest expression in heart, stomach, bladder and small intestine. {ECO
• Sequence:

  MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYANCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERS
  PQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFASDFPPETQRA
  WAKLRGLIYSHVTAAYKEVGWVQQVPNATTPPATLPSSGP

• Structural information:
  • Interpro: IPR000971  IPR009050  IPR012292  IPR013314  
  • Prosite: PS01033
  • PDB: 1UMO 1URV 1URY 1UT0 1UX9 1V5H 2DC3 3AG0 4B3W
  • PDBsum: 1UMO 1URV 1URY 1UT0 1UX9 1V5H 2DC3 3AG0 4B3W
  • STRING: ENSP00000293230
• Other Databases: GeneCards:  CYGB  Malacards:  CYGB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005506	iron ion binding	IEA	molecular function
GO:0020037	heme binding	IEA	molecular function
GO:0015671	oxygen transport	IEA	biological process
GO:0019825	oxygen binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005344	oxygen carrier activity	IEA	molecular function
GO:0015671	oxygen transport	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0015671	oxygen transport	TAS	biological process
GO:0050999	regulation of nitric-oxide synthase activity	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032966	negative regulation of collagen biosynthetic process	IEA	biological process
GO:0020037	heme binding	IEA	molecular function
GO:0010764	negative regulation of fibroblast migration	IEA	biological process
GO:0004601	peroxidase activity	IEA	molecular function
GO:0001666	response to hypoxia	IEA	biological process
GO:0043005	neuron projection	IEA	cellular component
GO:2000490	negative regulation of hepatic stellate cell activation	IEA	biological process
GO:0047888	fatty acid peroxidase activity	IEA	molecular function
GO:0019395	fatty acid oxidation	IEA	biological process
GO:0006979	response to oxidative stress	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0004096	catalase activity	IEA	molecular function
GO:0043025	neuronal cell body	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0015671	oxygen transport	NAS	biological process
GO:0005344	oxygen carrier activity	NAS	molecular function
GO:0004601	peroxidase activity	ISS	molecular function
GO:0006979	response to oxidative stress	ISS	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989
Oligozoospermia	MIK: 21989496

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
21989496	Oligozoospermia			11 (8 infertile and 3 fertile men)	Male infertility	Microarray