• Gene id: 114609

Gene Summary

• Gene Symbol: TIRAP   Gene   UCSC   Ensembl
• Aliases: BACTS1, Mal, MyD88-2, wyatt
• Gene name: TIR domain containing adaptor protein
• Alternate names: toll/interleukin-1 receptor domain-containing adapter protein, MyD88 adapter-like protein, Toll-like receptor adaptor protein, adapter protein wyatt, adaptor protein Wyatt, toll-interleukin 1 receptor (TIR) domain containing adaptor protein,
• Gene location: 11q24.2 (126283086: 126294932)     Exons: 6     NC_000011.10
• Gene summary(Entrez): The innate immune system recognizes microbial pathogens through Toll-like receptors (TLRs), which identify pathogen-associated molecular patterns. Different TLRs recognize different pathogen-associated molecular patterns and all TLRs have a Toll-interleuk
• OMIM: 606252

Protein Summary

• Protein general information: P58753  
  • Name: Toll/interleukin 1 receptor domain containing adapter protein (TIR domain containing adapter protein) (Adaptor protein Wyatt) (MyD88 adapter like protein) (MyD88 2)
  • Length: 221  
  • Mass: 23883
  • Tissue specificity: Highly expressed in liver, kidney, spleen, skeletal muscle and heart. Also detected in peripheral blood leukocytes, lung, placenta, small intestine, thymus, colon and brain.
• Sequence:

  MASSTSLPAPGSRPKKPLGKMADWFRQTLLKKPKKRPNSPESTSSDASQPTSQDSPLPPSLSSVTSPSLPPTHAS
  DSGSSRWSKDYDVCVCHSEEDLVAAQDLVSYLEGSTASLRCFLQLRDATPGGAIVSELCQALSSSHCRVLLITPG
  FLQDPWCKYQMLQALTEAPGAEGCTIPLLSGLSRAAYPPELRFMYYVDGRGPDGGFRQVKEAVMRYLQTLS

• Structural information:
  • Protein Domains: (84..21-)
    (/note="TIR-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00204"-)
  • Interpro: IPR000157  IPR017279  IPR035897  
  • Prosite: PS50104
  • PDB: 2NDH 2Y92 3UB2 3UB3 3UB4 4FZ5 4LQD 5T7Q 5UZB
  • PDBsum: 2NDH 2Y92 3UB2 3UB3 3UB4 4FZ5 4LQD 5T7Q 5UZB
  • DIP: 33489
  • STRING: ENSP00000376445
• Other Databases: GeneCards:  TIRAP  Malacards:  TIRAP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0006954	inflammatory response	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007250	activation of NF-kappaB-inducing kinase activity	IMP	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0002755	MyD88-dependent toll-like receptor signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005080	protein kinase C binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005546	phosphatidylinositol-4,5-bisphosphate binding	ISS	molecular function
GO:0030674	protein-macromolecule adaptor activity	NAS	molecular function
GO:0035662	Toll-like receptor 4 binding	IPI	molecular function
GO:0035663	Toll-like receptor 2 binding	IPI	molecular function
GO:0042802	identical protein binding	ISS	molecular function
GO:0031334	positive regulation of protein-containing complex assembly	IDA	biological process
GO:0002755	MyD88-dependent toll-like receptor signaling pathway	TAS	biological process
GO:0030099	myeloid cell differentiation	ISS	biological process
GO:0032587	ruffle membrane	ISS	cellular component
GO:0032648	regulation of interferon-beta production	ISS	biological process
GO:0032757	positive regulation of interleukin-8 production	IMP	biological process
GO:0034137	positive regulation of toll-like receptor 2 signaling pathway	IMP	biological process
GO:0034141	positive regulation of toll-like receptor 3 signaling pathway	ISS	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IMP	biological process
GO:0050830	defense response to Gram-positive bacterium	ISS	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IMP	biological process
GO:2000340	positive regulation of chemokine (C-X-C motif) ligand 1 production	ISS	biological process
GO:2000343	positive regulation of chemokine (C-X-C motif) ligand 2 production	ISS	biological process
GO:0032496	response to lipopolysaccharide	IDA	biological process
GO:0032738	positive regulation of interleukin-15 production	IDA	biological process
GO:0035665	TIRAP-dependent toll-like receptor 4 signaling pathway	IDA	biological process
GO:0045088	regulation of innate immune response	IC	biological process
GO:0070935	3'-UTR-mediated mRNA stabilization	IDA	biological process
GO:0007166	cell surface receptor signaling pathway	ISS	biological process
GO:0030139	endocytic vesicle	ISS	cellular component
GO:0030890	positive regulation of B cell proliferation	ISS	biological process
GO:0032735	positive regulation of interleukin-12 production	ISS	biological process
GO:0032760	positive regulation of tumor necrosis factor production	IMP	biological process
GO:0032760	positive regulation of tumor necrosis factor production	IMP	biological process
GO:0034145	positive regulation of toll-like receptor 4 signaling pathway	IMP	biological process
GO:0045410	positive regulation of interleukin-6 biosynthetic process	IMP	biological process
GO:0046330	positive regulation of JNK cascade	IMP	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IMP	biological process
GO:0071221	cellular response to bacterial lipopeptide	ISS	biological process
GO:0071223	cellular response to lipoteichoic acid	ISS	biological process
GO:0090023	positive regulation of neutrophil chemotaxis	ISS	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05132	Salmonella infection
hsa05130	Pathogenic Escherichia coli infection
hsa05152	Tuberculosis
hsa05161	Hepatitis B
hsa04064	NF-kappa B signaling pathway
hsa04620	Toll-like receptor signaling pathway
hsa05235	PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05133	Pertussis

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)