About Us

Search Result


Gene id 114569
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary

Gene Symbol MAL2   Gene   UCSC   Ensembl
Gene name mal, T cell differentiation protein 2
Alternate names protein MAL2, MAL proteolipid protein 2, MAL2 proteolipid protein, myelin and lymphocyte protein 2,
Gene location 8q24.12 (119208362: 119245672)     Exons: 4     NC_000008.11
Gene summary(Entrez) This gene encodes a multispan transmembrane protein belonging to the MAL proteolipid family. The protein is a component of lipid rafts and, in polarized cells, it primarily localizes to endosomal structures beneath the apical membrane. It is required for
OMIM 609684

Protein Summary

Protein general information Q969L2  

Name: Protein MAL2

Length: 176  Mass: 19125

Tissue specificity: Predominantly expressed in kidney, lung, and liver. Also found in thyroid gland, stomach and, at lower levels in testis and small intestine. {ECO

Sequence MSAGGASVPPPPNPAVSFPPPRVTLPAGPDILRTYSGAFVCLEILFGGLVWILVASSNVPLPLLQGWVMFVSVTA
FFFSLLFLGMFLSGMVAQIDANWNFLDFAYHFTVFVFYFGAFLLEAAATSLHDLHCNTTITGQPLLSDNQYNINV
AASIFAFMTTACYGCSLGLALRRWRP
Structural information
Protein Domains
(31..17-)
(/note="MARVEL-)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00581"-)
Interpro:  IPR013295  IPR033240  IPR008253  
Prosite:   PS51225
STRING:   ENSP00000479708
Other Databases GeneCards:  MAL2  Malacards:  MAL2

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0042552 myelination
IBA biological process
GO:0019911 structural constituent of
myelin sheath
IBA molecular function
GO:0016021 integral component of mem
brane
IBA cellular component
GO:0045056 transcytosis
IEA biological process
GO:0045121 membrane raft
IEA cellular component
GO:0016020 membrane
IEA cellular component
GO:0016020 membrane
IEA cellular component
GO:0005737 cytoplasm
IEA cellular component
GO:0016021 integral component of mem
brane
IEA cellular component
GO:0005886 plasma membrane
IEA cellular component
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0016324 apical plasma membrane
IEA cellular component
GO:0005886 plasma membrane
IEA cellular component
GO:0048471 perinuclear region of cyt
oplasm
IEA cellular component
GO:0012505 endomembrane system
IEA cellular component
GO:0045121 membrane raft
IDA cellular component
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0070062 extracellular exosome
HDA cellular component
Associated diseases References
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia

19 (6 controls
, 13 cases)
Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract