• Gene id: 114335

Gene Summary

• Gene Symbol: CGB1   Gene   UCSC   Ensembl
• Gene name: chorionic gonadotropin subunit beta 1
• Alternate names: choriogonadotropin subunit beta variant 1, chorionic gonadotropin beta subunit 1, chorionic gonadotropin, beta polypeptide 1,
• Gene location: 19q13.33 (49036933: 49035568)     Exons: 3     NC_000019.10
• Gene summary(Entrez): The beta subunit of chorionic gonadotropin (CGB) is encoded by six highly homologous and structurally similar genes that are arranged in tandem and inverted pairs on chromosome 19q13.3, and contiguous with the luteinizing hormone beta (LHB) subunit gene.
• OMIM: 601157

Protein Summary

• Protein general information: A6NKQ9  
  • Name: Choriogonadotropin subunit beta variant 1
  • Length: 187  
  • Mass: 20468
  • Tissue specificity: Expressed in placenta, testis and pituitary. {ECO
• Sequence:

  MSTFPVLAEDIPLRERHVKGRVDPHFRAPKMEMFQRLLLLLLLSMGGTWASKEPLRPRCRPINATLAVEKEGCPV
  CITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDC
  GGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGP

• Structural information:
  • Interpro: IPR029034  IPR006208  IPR001545  IPR018245  
  • Prosite: PS00261 PS00689
  • CDD: cd00069
• Other Databases: GeneCards:  CGB1  Malacards:  CGB1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0009755	hormone-mediated signaling pathway	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005179	hormone activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005179	hormone activity	IEA	molecular function
GO:0005179	hormone activity	IMP	molecular function
GO:0005576	extracellular region	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq