About Us

Search Result


Gene id 114327
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary

Gene Symbol EFHC1   Gene   UCSC   Ensembl
Aliases EJM1, POC9, RIB72, dJ304B14.2
Gene name EF-hand domain containing 1
Alternate names EF-hand domain-containing protein 1, EF-hand domain (C-terminal) containing 1, myoclonin-1,
Gene location 6p12.2 (52420341: 52497197)     Exons: 12     NC_000006.12
Gene summary(Entrez) This gene encodes an EF-hand-containing calcium binding protein. The encoded protein likely plays a role in calcium homeostasis. Mutations in this gene have been associated with susceptibility to juvenile myoclonic epilepsy and juvenile absence epilepsy.
OMIM 608815

Protein Summary

Protein general information Q5JVL4  

Name: EF hand domain containing protein 1 (Myoclonin 1)

Length: 640  Mass: 73990

Tissue specificity: Widely expressed. Not detected in lymphocytes. {ECO

Sequence MVSNPVHGLPFLPGTSFKDSTKTAFHRSQTLSYRNGYAIVRRPTVGIGGDRLQFNQLSQAELDELASKAPVLTYG
QPKQAPPADFIPAHVAFDKKVLKFDAYFQEDVPMSTEEQYRIRQVNIYYYLEDDSMSVIEPVVENSGILQGKLIK
RQRLAKNDRGDHYHWKDLNRGINITIYGKTFRVVDCDQFTQVFLESQGIELNPPEKMALDPYTELRKQPLRKYVT
PSDFDQLKQFLTFDKQVLRFYAIWDDTDSMYGECRTYIIHYYLMDDTVEIREVHERNDGRDPFPLLMNRQRVPKV
LVENAKNFPQCVLEISDQEVLEWYTAKDFIVGKSLTILGRTFFIYDCDPFTRRYYKEKFGITDLPRIDVSKREPP
PVKQELPPYNGFGLVEDSAQNCFALIPKAPKKDVIKMLVNDNKVLRYLAVLESPIPEDKDRRFVFSYFLATDMIS
IFEPPVRNSGIIGGKYLGRTKVVKPYSTVDNPVYYGPSDFFIGAVIEVFGHRFIILDTDEYVLKYMESNAAQYSP
EALASIQNHVRKREAPAPEAESKQTEKDPGVQELEALIDTIQKQLKDHSCKDNIREAFQIYDKEASGYVDRDMFF
KICESLNVPVDDSLVKELIRMCSHGEGKINYYNFVRAFSN
Structural information
Protein Domains
(93..19-)
(/note="DM10-1)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00665-)
(239..35-)
(/note="DM10-2)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00665-)
(416..52-)
(/note="DM10-3)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00665-)
(-)
Interpro:  IPR010554  IPR011992  IPR002048  IPR040193  IPR006602  
Prosite:   PS51336 PS50222
CDD:   cd00051
MINT:  
STRING:   ENSP00000360107
Other Databases GeneCards:  EFHC1  Malacards:  EFHC1

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0005930 axoneme
IBA cellular component
GO:0007052 mitotic spindle organizat
ion
IBA biological process
GO:0060285 cilium-dependent cell mot
ility
IBA biological process
GO:0000281 mitotic cytokinesis
IBA biological process
GO:0043014 alpha-tubulin binding
IBA molecular function
GO:0072686 mitotic spindle
IBA cellular component
GO:0005813 centrosome
IDA cellular component
GO:0072686 mitotic spindle
IDA cellular component
GO:0000922 spindle pole
IDA cellular component
GO:0072686 mitotic spindle
IDA cellular component
GO:0043014 alpha-tubulin binding
IDA molecular function
GO:0021795 cerebral cortex cell migr
ation
IMP biological process
GO:0007052 mitotic spindle organizat
ion
IMP biological process
GO:0007052 mitotic spindle organizat
ion
IMP biological process
GO:0000281 mitotic cytokinesis
IMP biological process
GO:0051302 regulation of cell divisi
on
IMP biological process
GO:0005509 calcium ion binding
IEA molecular function
GO:0005737 cytoplasm
IEA cellular component
GO:0005856 cytoskeleton
IEA cellular component
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0000922 spindle pole
IEA cellular component
GO:0005815 microtubule organizing ce
nter
IEA cellular component
GO:0005819 spindle
IEA cellular component
GO:0043025 neuronal cell body
ISS cellular component
GO:0008022 protein C-terminus bindin
g
ISS molecular function
GO:0005930 axoneme
ISS cellular component
Associated diseases References
Juvenile myoclonic epilepsy KEGG:H02217
Juvenile absence epilepsy KEGG:H02216
Juvenile myoclonic epilepsy KEGG:H02217
Juvenile absence epilepsy KEGG:H02216
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Spermatogenic defects MIK: 31037746
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia

19 (6 controls
, 13 cases)
Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm

18
Male infertility GSE26881
Show abstract
31037746 Spermatoge
nic defect
s

28 men with az
oospermia
Male infertility Microarray
Show abstract