• Gene id: 114132

Gene Summary

• Gene Symbol: SIGLEC11   Gene   UCSC   Ensembl
• Gene name: sialic acid binding Ig like lectin 11
• Alternate names: sialic acid-binding Ig-like lectin 11, siglec-11,
• Gene location: 19q13.33 (49961171: 49948824)     Exons: 11     NC_000019.10
• Gene summary(Entrez): This gene encodes a member of the sialic acid-binding immunoglobulin-like lectin family. These cell surface lectins are characterized by structural motifs in the immunoglobulin (Ig)-like domains and sialic acid recognition sites in the first Ig V set doma
• OMIM: 607157

Protein Summary

• Protein general information: Q96RL6  
  • Name: Sialic acid binding Ig like lectin 11 (Sialic acid binding lectin 11) (Siglec 11)
  • Length: 698  
  • Mass: 75795
  • Tissue specificity: Expressed by macrophages in various tissues including Kupffer cells. Also found in brain microglia.
• Sequence:

  MVPGQAQPQSPEMLLLPLLLPVLGAGSLNKDPSYSLQVQRQVPVPEGLCVIVSCNLSYPRDGWDESTAAYGYWFK
  GRTSPKTGAPVATNNQSREVEMSTRDRFQLTGDPGKGSCSLVIRDAQREDEAWYFFRVERGSRVRHSFLSNAFFL
  KVTALTKKPDVYIPETLEPGQPVTVICVFNWAFKKCPAPSFSWTGAALSPRRTRPSTSHFSVLSFTPSPQDHDTD
  LTCHVDFSRKGVSAQRTVRLRVAYAPKDLIISISHDNTSALELQGNVIYLEVQKGQFLRLLCAADSQPPATLSWV
  LQDRVLSSSHPWGPRTLGLELRGVRAGDSGRYTCRAENRLGSQQQALDLSVQYPPENLRVMVSQANRTVLENLGN
  GTSLPVLEGQSLRLVCVTHSSPPARLSWTRWGQTVGPSQPSDPGVLELPPIQMEHEGEFTCHAQHPLGSQHVSLS
  LSVHYPPQLLGPSCSWEAEGLHCSCSSQASPAPSLRWWLGEELLEGNSSQGSFEVTPSSAGPWANSSLSLHGGLS
  SGLRLRCKAWNVHGAQSGSVFQLLPGKLEHGGGLGLGAALGAGVAALLAFCSCLVVFRVKICRKEARKRAAAEQD
  VPSTLGPISQGHQHECSAGSSQDHPPPGAATYTPGKGEEQELHYASLSFQGLRLWEPADQEAPSTTEYSEIKIHT
  GQPLRGPGFGLQLEREMSGMVPK

• Structural information:
  • Protein Domains: (31..13-)
    (/note="Ig-like-V-type)
    (159..24-)
    1 (/note="Ig-like-C2-type)
    (251..35-)
    2 (/note="Ig-like-C2-type)
    (355..45-)
    3" (/note="Ig-like-C2-type)
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003006  IPR013098   IPR003599  IPR003598  IPR013106  
  • Prosite: PS50835 PS00290
  • STRING: ENSP00000412361
• Other Databases: GeneCards:  SIGLEC11  Malacards:  SIGLEC11

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007155	cell adhesion	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0033691	sialic acid binding	IBA	molecular function
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0007155	cell adhesion	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0033691	sialic acid binding	IDA	molecular function
GO:0019902	phosphatase binding	IPI	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq