• Gene id: 114131

Gene Summary

• Gene Symbol: UCN3   Gene   UCSC   Ensembl
• Aliases: SCP, SPC, UCNIII
• Gene name: urocortin 3
• Alternate names: urocortin-3, prepro-urocortin 3, stresscopin, ucn III, urocortin III,
• Gene location: 10p15.1 (5364965: 5374691)     Exons: 2     NC_000010.11
• Gene summary(Entrez): This gene encodes a member of the sauvagine/corticotropin-releasing factor/urotensin I family of proteins. The encoded preproprotein is proteolytically processed to generate the mature peptide hormone, which is secreted by pancreatic beta and alpha cells.
• OMIM: 617310

Protein Summary

• Protein general information: Q969E3  
  • Name: Urocortin 3 (Stresscopin) (Urocortin III) (Ucn III)
  • Length: 161  
  • Mass: 17961
• Sequence:

  MLMPVHFLLLLLLLLGGPRTGLPHKFYKAKPIFSCLNTALSEAEKGQWEDASLLSKRSFHYLRSRDASSGEEEEG
  KEKKTFPISGARGGARGTRYRYVSQAQPRGKPRQDTAKSPHRTKFTLSLDVPTNIMNLLFNIAKAKNLRAQAAAN
  AHLMAQIGRKK

• Structural information:
  • Interpro: IPR000187  IPR024270  
  • PDB: 2RMH 3N93
  • PDBsum: 2RMH 3N93
  • STRING: ENSP00000369798
• Other Databases: GeneCards:  UCN3  Malacards:  UCN3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA	biological process
GO:0009755	hormone-mediated signaling pathway	IBA	biological process
GO:0031669	cellular response to nutrient levels	IBA	biological process
GO:0051429	corticotropin-releasing hormone receptor binding	IBA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0051431	corticotropin-releasing hormone receptor 2 binding	IEA	molecular function
GO:0005179	hormone activity	IEA	molecular function
GO:0007586	digestion	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005179	hormone activity	IEA	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0071456	cellular response to hypoxia	IEA	biological process
GO:0045838	positive regulation of membrane potential	IEA	biological process
GO:0043005	neuron projection	IEA	cellular component
GO:0042594	response to starvation	IEA	biological process
GO:0030424	axon	IEA	cellular component
GO:0009749	response to glucose	IEA	biological process
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA	biological process
GO:0051412	response to corticosterone	IEA	biological process
GO:0043679	axon terminus	IEA	cellular component
GO:0043196	varicosity	IEA	cellular component
GO:0035902	response to immobilization stress	IEA	biological process
GO:0032024	positive regulation of insulin secretion	IEA	biological process
GO:0031669	cellular response to nutrient levels	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0009755	hormone-mediated signaling pathway	IDA	biological process
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	biological process
GO:0051429	corticotropin-releasing hormone receptor binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881