• Gene id: 114088

Gene Summary

• Gene Symbol: TRIM9   Gene   UCSC   Ensembl
• Aliases: RNF91, SPRING
• Gene name: tripartite motif containing 9
• Alternate names: E3 ubiquitin-protein ligase TRIM9, RING finger protein 91, RING-type E3 ubiquitin transferase TRIM9, SNAP-25-interacting RING finger protein, homolog of rat RING finger Spring, tripartite motif-containing protein 9,
• Gene location: 14q22.1 (134373311: 134428789)     Exons: 10     NC_000023.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. Its f
• OMIM: 606555

Protein Summary

• Protein general information: Q9C026  
  • Name: E3 ubiquitin protein ligase TRIM9 (EC 2.3.2.27) (RING finger protein 91) (RING type E3 ubiquitin transferase TRIM9) (Tripartite motif containing protein 9)
  • Length: 710  
  • Mass: 79177
  • Tissue specificity: Brain. Highly expressed in the cerebral cortex (at protein level). Severely decreased in the affected brain areas in Parkinson disease and dementia with Lewy bodies. {ECO
• Sequence:

  MEEMEEELKCPVCGSFYREPIILPCSHNLCQACARNILVQTPESESPQSHRAAGSGVSDYDYLDLDKMSLYSEAD
  SGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPPATHLSPALAPVPRNSCITCPQCHRSLILDDRGLRGFPKNRV
  LEGVIDRYQQSKAAALKCQLCEKAPKEATVMCEQCDVFYCDPCRLRCHPPRGPLAKHRLVPPAQGRVSRRLSPRK
  VSTCTDHELENHSMYCVQCKMPVCYQCLEEGKHSSHEVKALGAMWKLHKSQLSQALNGLSDRAKEAKEFLVQLRN
  MVQQIQENSVEFEACLVAQCDALIDALNRRKAQLLARVNKEHEHKLKVVRDQISHCTVKLRQTTGLMEYCLEVIK
  ENDPSGFLQISDALIRRVHLTEDQWGKGTLTPRMTTDFDLSLDNSPLLQSIHQLDFVQVKASSPVPATPILQLEE
  CCTHNNSATLSWKQPPLSTVPADGYILELDDGNGGQFREVYVGKETMCTVDGLHFNSTYNARVKAFNKTGVSPYS
  KTLVLQTSEVAWFAFDPGSAHSDIILSNDNLTVTCSSYDDRVVLGKTGFSKGIHYWELTVDRYDNHPDPAFGVAR
  MDVMKDVMLGKDDKAWAMYVDNNRSWFMHNNSHTNRTEGGITKGATIGVLLDLNRKNLTFFINDEQQGPIAFDNV
  EGLFFPAVSLNRNVQVTLHTGLPVPDFYSSRASIA

• Structural information:
  • Protein Domains: (374..43-)
    (/note="COS-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00586-)
    (440..53-)
    (/note="Fibronectin-type-III)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00316-)
    (533..70-)
    (/note="B30.2/SPRY-)
    (/evidence="ECO:0000255|PROSITE-ProR-)
  • Interpro: IPR001870  IPR003649  IPR013320  IPR017903  IPR003961   IPR036116  IPR013783  IPR003877  IPR000315  IPR001841  IPR013083  IPR017907  
  • Prosite: PS50188 PS51262 PS50853 PS50119 PS00518 PS50089
  • CDD: cd00063
  • PDB: 2DB8
  • PDBsum: 2DB8
  • STRING: ENSP00000298355
• Other Databases: GeneCards:  TRIM9  Malacards:  TRIM9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030425	dendrite	IDA	cellular component
GO:0061630	ubiquitin protein ligase activity	IDA	molecular function
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0008270	zinc ion binding	IEA	molecular function
GO:0030054	cell junction	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008021	synaptic vesicle	IEA	cellular component
GO:0016079	synaptic vesicle exocytosis	IEA	biological process
GO:0045955	negative regulation of calcium ion-dependent exocytosis	IEA	biological process
GO:0099523	presynaptic cytosol	IEA	cellular component
GO:0000149	SNARE binding	IEA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0035544	negative regulation of SNARE complex assembly	IEA	biological process
GO:0008021	synaptic vesicle	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0019904	protein domain specific binding	IPI	molecular function
GO:0019904	protein domain specific binding	IPI	molecular function
GO:0019904	protein domain specific binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881