• Gene id: 114

Gene Summary

• Gene Symbol: ADCY8   Gene   UCSC   Ensembl
• Aliases: AC8, ADCY3, HBAC1
• Gene name: adenylate cyclase 8
• Alternate names: adenylate cyclase type 8, ATP pyrophosphate-lyase 8, HEL-S-172mP, adenylate cyclase 8 (brain), adenylate cyclase type VIII, adenylyl cyclase 8, adenylyl cyclase-8, brain, ca(2+)/calmodulin-activated adenylyl cyclase, epididymis secretory sperm binding protein Li ,
• Gene location: 8q24.22 (131041603: 130780299)     Exons: 19     NC_000008.11
• Gene summary(Entrez): Adenylate cyclase is a membrane bound enzyme that catalyses the formation of cyclic AMP from ATP. The enzymatic activity is under the control of several hormones, and different polypeptides participate in the transduction of the signal from the receptor t
• OMIM: 103070

Protein Summary

• Protein general information: P40145  
  • Name: Adenylate cyclase type 8 (EC 4.6.1.1) (ATP pyrophosphate lyase 8) (Adenylate cyclase type VIII) (Adenylyl cyclase 8) (AC8) (Ca(2+)/calmodulin activated adenylyl cyclase)
  • Length: 1251  
  • Mass: 140122
  • Tissue specificity: Detected in brain cortex (PubMed
• Sequence:

  MELSDVRCLTGSEELYTIHPTPPAGDGRSASRPQRLLWQTAVRHITEQRFIHGHRGGSGSGSGGSGKASDPAGGG
  PNHHAPQLSGDSALPLYSLGPGERAHSTCGTKVFPERSGSGSASGSGGGGDLGFLHLDCAPSNSDFFLNGGYSYR
  GVIFPTLRNSFKSRDLERLYQRYFLGQRRKSEVVMNVLDVLTKLTLLVLHLSLASAPMDPLKGILLGFFTGIEVV
  ICALVVVRKDTTSHTYLQYSGVVTWVAMTTQILAAGLGYGLLGDGIGYVLFTLFATYSMLPLPLTWAILAGLGTS
  LLQVILQVVIPRLAVISINQVVAQAVLFMCMNTAGIFISYLSDRAQRQAFLETRRCVEARLRLETENQRQERLVL
  SVLPRFVVLEMINDMTNVEDEHLQHQFHRIYIHRYENVSILFADVKGFTNLSTTLSAQELVRMLNELFARFDRLA
  HEHHCLRIKILGDCYYCVSGLPEPRQDHAHCCVEMGLSMIKTIRYVRSRTKHDVDMRIGIHSGSVLCGVLGLRKW
  QFDVWSWDVDIANKLESGGIPGRIHISKATLDCLNGDYNVEEGHGKERNEFLRKHNIETYLIKQPEDSLLSLPED
  IVKESVSSSDRRNSGATFTEGSWSPELPFDNIVGKQNTLAALTRNSINLLPNHLAQALHVQSGPEEINKRIEHTI
  DLRSGDKLRREHIKPFSLMFKDSSLEHKYSQMRDEVFKSNLVCAFIVLLFITAIQSLLPSSRVMPMTIQFSILIM
  LHSALVLITTAEDYKCLPLILRKTCCWINETYLARNVIIFASILINFLGAILNILWCDFDKSIPLKNLTFNSSAV
  FTDICSYPEYFVFTGVLAMVTCAVFLRLNSVLKLAVLLIMIAIYALLTETVYAGLFLRYDNLNHSGEDFLGTKEV
  SLLLMAMFLLAVFYHGQQLEYTARLDFLWRVQAKEEINEMKELREHNENMLRNILPSHVARHFLEKDRDNEELYS
  QSYDAVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADFDELLGEDRFQDIEKIKTIGSTYMAVSGLSPEK
  QQCEDKWGHLCALADFSLALTESIQEINKHSFNNFELRIGISHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTG
  VSGRIQVPEETYLILKDQGFAFDYRGEIYVKGISEQEGKIKTYFLLGRVQPNPFILPPRRLPGQYSLAAVVLGLV
  QSLNRQRQKQLLNENNNTGIIKGHYNRRTLLSPSGTEPGAQAEGTDKSDLP

• Structural information:
  • Interpro: IPR001054  IPR018297  IPR032628  IPR030672  IPR009398   IPR029787  
  • Prosite: PS00452 PS50125
  • STRING: ENSP00000286355
• Other Databases: GeneCards:  ADCY8  Malacards:  ADCY8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA	biological process
GO:0004016	adenylate cyclase activity	IBA	molecular function
GO:0007193	adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IBA	biological process
GO:0006171	cAMP biosynthetic process	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0042593	glucose homeostasis	ISS	biological process
GO:0010255	glucose mediated signaling pathway	ISS	biological process
GO:0003779	actin binding	ISS	molecular function
GO:0005905	clathrin-coated pit	ISS	cellular component
GO:0042803	protein homodimerization activity	ISS	molecular function
GO:0071277	cellular response to calcium ion	ISS	biological process
GO:0005516	calmodulin binding	ISS	molecular function
GO:0030424	axon	ISS	cellular component
GO:0051480	regulation of cytosolic calcium ion concentration	ISS	biological process
GO:0035774	positive regulation of insulin secretion involved in cellular response to glucose stimulus	ISS	biological process
GO:0015629	actin cytoskeleton	ISS	colocalizes with
GO:0008294	calcium- and calmodulin-responsive adenylate cyclase activity	ISS	molecular function
GO:0051259	protein complex oligomerization	ISS	biological process
GO:0007613	memory	ISS	biological process
GO:0007626	locomotory behavior	ISS	biological process
GO:0045121	membrane raft	ISS	cellular component
GO:0030425	dendrite	ISS	cellular component
GO:0030425	dendrite	ISS	cellular component
GO:0016323	basolateral plasma membrane	ISS	cellular component
GO:0031915	positive regulation of synaptic plasticity	ISS	biological process
GO:0150076	neuroinflammatory response	ISS	biological process
GO:0008294	calcium- and calmodulin-responsive adenylate cyclase activity	ISS	molecular function
GO:0032793	positive regulation of CREB transcription factor activity	ISS	biological process
GO:0034199	activation of protein kinase A activity	ISS	biological process
GO:0071333	cellular response to glucose stimulus	ISS	biological process
GO:0035774	positive regulation of insulin secretion involved in cellular response to glucose stimulus	ISS	biological process
GO:0010255	glucose mediated signaling pathway	ISS	biological process
GO:0005901	caveola	ISS	cellular component
GO:0051721	protein phosphatase 2A binding	ISS	molecular function
GO:0014069	postsynaptic density	ISS	cellular component
GO:0071315	cellular response to morphine	ISS	biological process
GO:0032809	neuronal cell body membrane	ISS	cellular component
GO:0032809	neuronal cell body membrane	ISS	cellular component
GO:0046983	protein dimerization activity	ISS	molecular function
GO:0048786	presynaptic active zone	ISS	cellular component
GO:0014069	postsynaptic density	ISS	cellular component
GO:0060076	excitatory synapse	ISS	cellular component
GO:0016324	apical plasma membrane	ISS	cellular component
GO:0080135	regulation of cellular response to stress	ISS	biological process
GO:1900454	positive regulation of long-term synaptic depression	ISS	biological process
GO:1900273	positive regulation of long-term synaptic potentiation	ISS	biological process
GO:0071377	cellular response to glucagon stimulus	ISS	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	ISS	biological process
GO:0044853	plasma membrane raft	ISS	cellular component
GO:0071315	cellular response to morphine	ISS	biological process
GO:0038003	opioid receptor signaling pathway	ISS	biological process
GO:0016020	membrane	ISS	cellular component
GO:0005886	plasma membrane	ISS	cellular component
GO:1904322	cellular response to forskolin	ISS	biological process
GO:0046982	protein heterodimerization activity	ISS	molecular function
GO:0051260	protein homooligomerization	ISS	biological process
GO:0004016	adenylate cyclase activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0006171	cAMP biosynthetic process	IEA	biological process
GO:0009190	cyclic nucleotide biosynthetic process	IEA	biological process
GO:0016849	phosphorus-oxygen lyase activity	IEA	molecular function
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0016829	lyase activity	IEA	molecular function
GO:0005905	clathrin-coated pit	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0045202	synapse	IEA	cellular component
GO:0006171	cAMP biosynthetic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004016	adenylate cyclase activity	TAS	molecular function
GO:0008294	calcium- and calmodulin-responsive adenylate cyclase activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0016020	membrane	TAS	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0007611	learning or memory	TAS	biological process
GO:0004016	adenylate cyclase activity	IEA	molecular function
GO:0003091	renal water homeostasis	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0007190	activation of adenylate cyclase activity	TAS	biological process
GO:0007193	adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	TAS	biological process
GO:0071377	cellular response to glucagon stimulus	TAS	biological process
GO:0004016	adenylate cyclase activity	TAS	molecular function
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	TAS	biological process
GO:0034199	activation of protein kinase A activity	TAS	biological process
GO:0004016	adenylate cyclase activity	IEA	molecular function
GO:0007613	memory	IEA	biological process
GO:0007616	long-term memory	IEA	biological process
GO:0007626	locomotory behavior	IEA	biological process
GO:0008294	calcium- and calmodulin-responsive adenylate cyclase activity	IEA	molecular function
GO:0010255	glucose mediated signaling pathway	IEA	biological process
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0031915	positive regulation of synaptic plasticity	IEA	biological process
GO:0032793	positive regulation of CREB transcription factor activity	IEA	biological process
GO:0035774	positive regulation of insulin secretion involved in cellular response to glucose stimulus	IEA	biological process
GO:0042593	glucose homeostasis	IEA	biological process
GO:0051480	regulation of cytosolic calcium ion concentration	IEA	biological process
GO:0098685	Schaffer collateral - CA1 synapse	IEA	cellular component
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0150076	neuroinflammatory response	IEA	biological process
GO:0014069	postsynaptic density	IEA	cellular component
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0032809	neuronal cell body membrane	IEA	cellular component
GO:0048786	presynaptic active zone	IEA	cellular component
GO:0050804	modulation of chemical synaptic transmission	IEA	biological process
GO:0060076	excitatory synapse	IEA	cellular component
GO:0071315	cellular response to morphine	IEA	biological process
GO:0080135	regulation of cellular response to stress	IEA	biological process
GO:0098686	hippocampal mossy fiber to CA3 synapse	IEA	cellular component
GO:0099056	integral component of presynaptic membrane	IEA	cellular component
GO:1900273	positive regulation of long-term synaptic potentiation	IEA	biological process
GO:1900454	positive regulation of long-term synaptic depression	IEA	biological process
GO:0030425	dendrite	IEA	cellular component
GO:0030665	clathrin-coated vesicle membrane	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0042734	presynaptic membrane	IEA	cellular component
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0005901	caveola	IEA	cellular component
GO:0005905	clathrin-coated pit	IEA	cellular component
GO:0045121	membrane raft	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0014069	postsynaptic density	IEA	cellular component
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa05200	Pathways in cancer
hsa04714	Thermogenesis
hsa04015	Rap1 signaling pathway
hsa04024	cAMP signaling pathway
hsa05166	Human T-cell leukemia virus 1 infection
hsa05163	Human cytomegalovirus infection
hsa04020	Calcium signaling pathway
hsa04062	Chemokine signaling pathway
hsa04022	cGMP-PKG signaling pathway
hsa04723	Retrograde endocannabinoid signaling
hsa00230	Purine metabolism
hsa04261	Adrenergic signaling in cardiomyocytes
hsa04934	Cushing syndrome
hsa04072	Phospholipase D signaling pathway
hsa04921	Oxytocin signaling pathway
hsa04371	Apelin signaling pathway
hsa04724	Glutamatergic synapse
hsa04270	Vascular smooth muscle contraction
hsa04114	Oocyte meiosis
hsa04611	Platelet activation
hsa04926	Relaxin signaling pathway
hsa04725	Cholinergic synapse
hsa04935	Growth hormone synthesis, secretion and action
hsa04915	Estrogen signaling pathway
hsa04916	Melanogenesis
hsa05032	Morphine addiction
hsa04727	GABAergic synapse
hsa04713	Circadian entrainment
hsa04925	Aldosterone synthesis and secretion
hsa04928	Parathyroid hormone synthesis, secretion and action
hsa04972	Pancreatic secretion
hsa05414	Dilated cardiomyopathy
hsa04750	Inflammatory mediator regulation of TRP channels
hsa04970	Salivary secretion
hsa04914	Progesterone-mediated oocyte maturation
hsa04912	GnRH signaling pathway
hsa04911	Insulin secretion
hsa04540	Gap junction
hsa04211	Longevity regulating pathway
hsa01522	Endocrine resistance
hsa04971	Gastric acid secretion
hsa04918	Thyroid hormone synthesis
hsa04742	Taste transduction
hsa04720	Long-term potentiation
hsa04976	Bile secretion
hsa04927	Cortisol synthesis and secretion
hsa04213	Longevity regulating pathway - multiple species
hsa04923	Regulation of lipolysis in adipocytes
hsa04913	Ovarian steroidogenesis

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)