• Gene id: 113829

Gene Summary

• Gene Symbol: SLC35A4   Gene   UCSC   Ensembl
• Gene name: solute carrier family 35 member A4
• Alternate names: probable UDP-sugar transporter protein SLC35A4, solute carrier family 35 (UDP-galactose transporter), member A4, tumor rejection antigen,
• Gene location: 5q31.3 (140564564: 140569103)     Exons: 3     NC_000005.10
• OMIM: 0

Protein Summary

• Protein general information: Q96G79  
  • Name: Probable UDP sugar transporter protein SLC35A4 (Solute carrier family 35 member A4)
  • Length: 324  
  • Mass: 34593
• Sequence:

  MSVEDGGMPGLGRPRQARWTLMLLLSTAMYGAHAPLLALCHVDGRVPFRPSSAVLLTELTKLLLCAFSLLVGWQA
  WPQGPPPWRQAAPFALSALLYGANNNLVIYLQRYMDPSTYQVLSNLKIGSTAVLYCLCLRHRLSVRQGLALLLLM
  AAGACYAAGGLQVPGNTLPSPPPAAAASPMPLHITPLGLLLLILYCLISGLSSVYTELLMKRQRLPLALQNLFLY
  TFGVLLNLGLHAGGGSGPGLLEGFSGWAALVVLSQALNGLLMSAVMKHGSSITRLFVVSCSLVVNAVLSAVLLRL
  QLTAAFFLATLLIGLAMRLYYGSR

• Structural information:
  • Interpro: IPR007271  
  • STRING: ENSP00000424566
• Other Databases: GeneCards:  SLC35A4  Malacards:  SLC35A4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0030173	integral component of Golgi membrane	IBA	cellular component
GO:0005794	Golgi apparatus	ISS	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0015165	pyrimidine nucleotide-sugar transmembrane transporter activity	IEA	molecular function
GO:0090481	pyrimidine nucleotide-sugar transmembrane transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0008643	carbohydrate transport	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881