• Gene id: 113791

Gene Summary

• Gene Symbol: PIK3IP1   Gene   UCSC   Ensembl
• Aliases: HGFL, TrIP, hHGFL(S)
• Gene name: phosphoinositide-3-kinase interacting protein 1
• Alternate names: phosphoinositide-3-kinase-interacting protein 1, kringle domain-containing protein HGFL, transmembrane inhibitor of PI3K,
• Gene location: 22q12.2 (31292533: 31281592)     Exons: 6     NC_000022.11
• OMIM: 600443

Protein Summary

• Protein general information: Q96FE7  
  • Name: Phosphoinositide 3 kinase interacting protein 1 (Kringle domain containing protein HGFL)
  • Length: 263  
  • Mass: 28248
• Sequence:

  MLLAWVQAFLVSNMLLAEAYGSGGCFWDNGHLYREDQTSPAPGLRCLNWLDAQSGLASAPVSGAGNHSYCRNPDE
  DPRGPWCYVSGEAGVPEKRPCEDLRCPETTSQALPAFTTEIQEASEGPGADEVQVFAPANALPARSEAAAVQPVI
  GISQRVRMNSKEKKDLGTLGYVLGITMMVIIIAIGAGIILGYSYKRGKDLKEQHDQKVCEREMQRITLPLSAFTN
  PTCEIVDEKTVVVHTSQTPVDPQEGTTPLMGQAGTPGA

• Structural information:
  • Protein Domains: (24..10-)
    (/note="Kringle-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00121"-)
  • Interpro: IPR000001  IPR013806  IPR018056  IPR038178  
  • Prosite: PS00021 PS50070
  • CDD: cd00108
  • STRING: ENSP00000215912
• Other Databases: GeneCards:  PIK3IP1  Malacards:  PIK3IP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004252	serine-type endopeptidase activity	IBA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043553	negative regulation of phosphatidylinositol 3-kinase activity	IEA	biological process
GO:0014067	negative regulation of phosphatidylinositol 3-kinase signaling	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0043553	negative regulation of phosphatidylinositol 3-kinase activity	IDA	biological process
GO:0014067	negative regulation of phosphatidylinositol 3-kinase signaling	IDA	biological process
GO:0043553	negative regulation of phosphatidylinositol 3-kinase activity	ISS	biological process
GO:0036313	phosphatidylinositol 3-kinase catalytic subunit binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881