• Gene id: 113746

Gene Summary

• Gene Symbol: ODF3   Gene   UCSC   Ensembl
• Aliases: CT135, SHIPPO1, TISP50
• Gene name: outer dense fiber of sperm tails 3
• Alternate names: outer dense fiber protein 3, cancer/testis antigen 135, sperm tail protein SHIPPO1, transcript induced in spermiogenesis protein 50,
• Gene location: 11p15.5 (196760: 200257)     Exons: 1     NC_000011.10
• Gene summary(Entrez): ODF3 is a component of sperm flagella outer dense fibers, which add stiffness, elastic recoil, and protection against shearing forces during sperm movement.[supplied by OMIM, Apr 2004]
• OMIM: 608356

Protein Summary

• Protein general information: Q96PU9  
  • Name: Outer dense fiber protein 3 (Outer dense fiber of sperm tails protein 3) (Sperm tail protein SHIPPO 1) (Transcript induced in spermiogenesis protein 50)
  • Length: 254  
  • Mass: 27710
  • Tissue specificity: Testis-specific. {ECO
• Sequence:

  MTEEVWMGTWRPHRPRGPIMALYSSPGPKYLIPPTTGFMKHTPTKLRAPAYSFRGAPMLLAENCSPGPRYNVNPK
  ILRTGKDLGPAYSILGRYQTKTMLTPGPGDYFPEKSTKYVFDSAPSHSISARTKAFRVDSTPGPAAYMLPMVMGP
  NTVGKASQPSFSIKGRSKLGGFSDDLHKTPGPAAYRQTDVRVTKFKAPQYTMAARVEPPGDKTLKPGPGAHSPEK
  VTLTKPCAPVVTFGIKHSDYMTPLLVDVE

• Structural information:
  • Interpro: IPR010736  
  • STRING: ENSP00000325868
• Other Databases: GeneCards:  ODF3  Malacards:  ODF3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001520	outer dense fiber	IBA	cellular component
GO:0005856	cytoskeleton	IBA	cellular component
GO:0007283	spermatogenesis	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001520	outer dense fiber	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Non obstructive azoospermia	MIK: 24012201
Sertoli cell only syndrome	MIK: 23869807

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
23869807	Non obstructive azoospermia, Sertoli cell only syndrome			20 (4 controls, 16 cases)	Male infertility	GSE45887 analyzed by GEO2R (cutoff 1.5 fold)