• Gene id: 113675

Gene Summary

• Gene Symbol: SDSL   Gene   UCSC   Ensembl
• Aliases: SDH 2, SDS-RS1, TDH, cSDH
• Gene name: serine dehydratase like
• Alternate names: serine dehydratase-like, L-serine deaminase, L-serine dehydratase/L-threonine deaminase, L-threonine dehydratase, serine dehydratase 2, serine dehydratase related sequence 1,
• Gene location: 12q24.13 (113422264: 113438276)     Exons: 11     NC_000012.12

Protein Summary

• Protein general information: Q96GA7  
  • Name: Serine dehydratase like (L serine deaminase) (L serine dehydratase/L threonine deaminase) (L threonine dehydratase) (TDH) (EC 4.3.1.19) (Serine dehydratase 2) (SDH 2) (EC 4.3.1.17)
  • Length: 329  
  • Mass: 34674
• Sequence:

  MDGPVAEHAKQEPFHVVTPLLESWALSQVAGMPVFLKCENVQPSGSFKIRGIGHFCQEMAKKGCRHLVCSSGGNA
  GIAAAYAARKLGIPATIVLPESTSLQVVQRLQGEGAEVQLTGKVWDEANLRAQELAKRDGWENVPPFDHPLIWKG
  HASLVQELKAVLRTPPGALVLAVGGGGLLAGVVAGLLEVGWQHVPIIAMETHGAHCFNAAITAGKLVTLPDITSV
  AKSLGAKTVAARALECMQVCKIHSEVVEDTEAVSAVQQLLDDERMLVEPACGAALAAIYSGLLRRLQAEGCLPPS
  LTSVVVIVCGGNNINSRELQALKTHLGQV

• Structural information:
  • Interpro: IPR001926  IPR000634  IPR036052  
  • Prosite: PS00165
  • PDB: 2RKB
  • PDBsum: 2RKB
  • STRING: ENSP00000385790
• Other Databases: GeneCards:  SDSL  Malacards:  SDSL

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006565	L-serine catabolic process	IBA	biological process
GO:0003941	L-serine ammonia-lyase activity	IBA	molecular function
GO:0004794	L-threonine ammonia-lyase activity	IBA	molecular function
GO:0006567	threonine catabolic process	IBA	biological process
GO:0030170	pyridoxal phosphate binding	IEA	molecular function
GO:0006520	cellular amino acid metabolic process	IEA	biological process
GO:0016829	lyase activity	IEA	molecular function
GO:0003941	L-serine ammonia-lyase activity	IEA	molecular function
GO:0004794	L-threonine ammonia-lyase activity	IEA	molecular function
GO:0019518	L-threonine catabolic process to glycine	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0008150	biological_process	ND	biological process
GO:0003674	molecular_function	ND	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa01200	Carbon metabolism
hsa01230	Biosynthesis of amino acids
hsa00270	Cysteine and methionine metabolism
hsa00260	Glycine, serine and threonine metabolism
hsa00290	Valine, leucine and isoleucine biosynthesis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray