• Gene id: 1136

Gene Summary

• Gene Symbol: CHRNA3   Gene   UCSC   Ensembl
• Aliases: BAIPRCK, LNCR2, NACHRA3, PAOD2
• Gene name: cholinergic receptor nicotinic alpha 3 subunit
• Alternate names: neuronal acetylcholine receptor subunit alpha-3, cholinergic receptor, nicotinic alpha 3, cholinergic receptor, nicotinic, alpha 3 (neuronal), cholinergic receptor, nicotinic, alpha polypeptide 3, neuronal nicotinic acetylcholine receptor, alpha3 subunit,
• Gene location: 15q25.1 (78620995: 78593051)     Exons: 18     NC_000015.10
• Gene summary(Entrez): This locus encodes a member of the nicotinic acetylcholine receptor family of proteins. Members of this family of proteins form pentameric complexes comprised of both alpha and beta subunits. This locus encodes an alpha-type subunit, as it contains charac
• OMIM: 118503

Protein Summary

• Protein general information: P32297  
  • Name: Neuronal acetylcholine receptor subunit alpha 3
  • Length: 505  
  • Mass: 57480
• Sequence:

  MGSGPLSLPLALSPPRLLLLLLLSLLPVARASEAEHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVD
  EVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPDIVLYNNAVGDFQVDDKTKALLKYTGEVTWI
  PPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLIGSSMNLKDYWESGEWAIIKAPGYKHDIKYNCCE
  EIYPDITYSLYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLV
  IPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPSWVKTVFLNLLPRVMFMTRPTSNEGNAQKPRPLYGA
  ELSNLNCFSRAESKGCKEGYPCQDGMCGYCHHRRIKISNFSANLTRSSSSESVDAVLSLSALSPEIKEAIQSVKY
  IAENMKAQNEAKEIQDDWKYVAMVIDRIFLWVFTLVCILGTAGLFLQPLMAREDA

• Structural information:
  • Interpro: IPR006202  IPR036734  IPR006201  IPR036719  IPR006029   IPR018000  IPR002394  
  • Prosite: PS00236
  • PDB: 4ZK4 5SYO 5TVC 6PV7 6PV8
  • PDBsum: 4ZK4 5SYO 5TVC 6PV7 6PV8
  • STRING: ENSP00000315602
• Other Databases: GeneCards:  CHRNA3  Malacards:  CHRNA3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0022848	acetylcholine-gated cation-selective channel activity	ISS	molecular function
GO:1905144	response to acetylcholine	ISS	biological process
GO:0044853	plasma membrane raft	ISS	cellular component
GO:0095500	acetylcholine receptor signaling pathway	ISS	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0007271	synaptic transmission, cholinergic	IBA	biological process
GO:0007274	neuromuscular synaptic transmission	IBA	biological process
GO:0030594	neurotransmitter receptor activity	IBA	molecular function
GO:0034220	ion transmembrane transport	IBA	biological process
GO:0035094	response to nicotine	IBA	biological process
GO:0042391	regulation of membrane potential	IBA	biological process
GO:0045202	synapse	IBA	cellular component
GO:0005892	acetylcholine-gated channel complex	IBA	cellular component
GO:0007165	signal transduction	IBA	biological process
GO:0007268	chemical synaptic transmission	IBA	biological process
GO:0042166	acetylcholine binding	IBA	contributes to
GO:0043005	neuron projection	IBA	cellular component
GO:0050877	nervous system process	IBA	biological process
GO:0022848	acetylcholine-gated cation-selective channel activity	TAS	molecular function
GO:0015276	ligand-gated ion channel activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005230	extracellular ligand-gated ion channel activity	IEA	molecular function
GO:0022848	acetylcholine-gated cation-selective channel activity	IEA	molecular function
GO:0004888	transmembrane signaling receptor activity	IEA	molecular function
GO:0005216	ion channel activity	IEA	molecular function
GO:0006811	ion transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0034220	ion transmembrane transport	IEA	biological process
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0042166	acetylcholine binding	IC	molecular function
GO:0007165	signal transduction	IDA	biological process
GO:0005892	acetylcholine-gated channel complex	IDA	cellular component
GO:0022848	acetylcholine-gated cation-selective channel activity	IDA	molecular function
GO:0015464	acetylcholine receptor activity	IDA	molecular function
GO:0035095	behavioral response to nicotine	IMP	biological process
GO:0007626	locomotory behavior	ISS	biological process
GO:0006940	regulation of smooth muscle contraction	ISS	biological process
GO:0060084	synaptic transmission involved in micturition	IMP	biological process
GO:0014069	postsynaptic density	ISS	cellular component
GO:0006811	ion transport	NAS	biological process
GO:0030425	dendrite	ISS	cellular component
GO:0007171	activation of transmembrane receptor protein tyrosine kinase activity	ISS	biological process
GO:0060079	excitatory postsynaptic potential	ISS	biological process
GO:0048814	regulation of dendrite morphogenesis	ISS	biological process
GO:0043025	neuronal cell body	ISS	cellular component
GO:0042391	regulation of membrane potential	ISS	biological process
GO:0016021	integral component of membrane	NAS	cellular component
GO:0014056	regulation of acetylcholine secretion, neurotransmission	ISS	biological process
GO:0007399	nervous system development	IMP	biological process
GO:0007271	synaptic transmission, cholinergic	ISS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04725	Cholinergic synapse

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881