• Gene id: 113451

Gene Summary

• Gene Symbol: AZIN2   Gene   UCSC   Ensembl
• Aliases: ADC, AZI2, AZIB1, ODC-p, ODC1L, ODCp
• Gene name: antizyme inhibitor 2
• Alternate names: antizyme inhibitor 2, ODC antizyme inhibitor-2, ODC-like protein, ODC-paralogue, arginine decarboxylase, ornithine decarboxylase like, ornithine decarboxylase-like protein, ornithine decarboxylase-paralog,
• Gene location: 1p35.1 (33081151: 33162287)     Exons: 15     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene belongs to the antizyme inhibitor family, which plays a role in cell growth and proliferation by maintaining polyamine homeostasis within the cell. Antizyme inhibitors are homologs of ornithine decarboxylase (ODC, the key
• OMIM: 608353

Protein Summary

• Protein general information: Q96A70  
  • Name: Antizyme inhibitor 2 (AzI2) (Arginine decarboxylase) (ADC) (ARGDC) (Ornithine decarboxylase like protein) (ODC like protein) (ornithine decarboxylase paralog) (ODC p)
  • Length: 460  
  • Mass: 49980
  • Tissue specificity: Expressed in the neocortex, thalamus, hippocampus, cerebellum, medulla oblongata, gray and white matter. Expressed in neurons, oligodendrocytes, basket, Purkinje and pyramidal cells. Expressed in spermatocytes and Leydig cells of the t
• Sequence:

  MAGYLSESDFVMVEEGFSTRDLLKELTLGASQATTDEVAAFFVADLGAIVRKHFCFLKCLPRVRPFYAVKCNSSP
  GVLKVLAQLGLGFSCANKAEMELVQHIGIPASKIICANPCKQIAQIKYAAKHGIQLLSFDNEMELAKVVKSHPSA
  KMVLCIATDDSHSLSCLSLKFGVSLKSCRHLLENAKKHHVEVVGVSFHIGSGCPDPQAYAQSIADARLVFEMGTE
  LGHKMHVLDLGGGFPGTEGAKVRFEEIASVINSALDLYFPEGCGVDIFAELGRYYVTSAFTVAVSIIAKKEVLLD
  QPGREEENGSTSKTIVYHLDEGVYGIFNSVLFDNICPTPILQKKPSTEQPLYSSSLWGPAVDGCDCVAEGLWLPQ
  LHVGDWLVFDNMGAYTVGMGSPFWGTQACHITYAMSRVAWEALRRQLMAAEQEDDVEGVCKPLSCGWEITDTLCV
  GPVFTPASIM

• Structural information:
  • Interpro: IPR009006  IPR031173  IPR022643  IPR022657  IPR022644   IPR022653  IPR000183  IPR002433  IPR029066  
  • Prosite: PS00878 PS00879
  • STRING: ENSP00000294517
• Other Databases: GeneCards:  AZIN2  Malacards:  AZIN2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0033387	putrescine biosynthetic process from ornithine	IBA	biological process
GO:0042978	ornithine decarboxylase activator activity	IBA	molecular function
GO:0043085	positive regulation of catalytic activity	IBA	biological process
GO:0004586	ornithine decarboxylase activity	IBA	NOT|molecular function
GO:0042177	negative regulation of protein catabolic process	IBA	biological process
GO:1902269	positive regulation of polyamine transmembrane transport	IBA	biological process
GO:0031410	cytoplasmic vesicle	IDA	cellular component
GO:0030425	dendrite	IDA	cellular component
GO:0030424	axon	IDA	cellular component
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0031410	cytoplasmic vesicle	IDA	cellular component
GO:0005802	trans-Golgi network	IDA	cellular component
GO:0042177	negative regulation of protein catabolic process	IDA	biological process
GO:1990005	granular vesicle	IDA	cellular component
GO:0043204	perikaryon	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0042978	ornithine decarboxylase activator activity	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005801	cis-Golgi network	ISS	cellular component
GO:0098629	trans-Golgi network membrane organization	IMP	biological process
GO:1902269	positive regulation of polyamine transmembrane transport	ISS	biological process
GO:0033116	endoplasmic reticulum-Golgi intermediate compartment membrane	ISS	cellular component
GO:0030133	transport vesicle	IMP	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042978	ornithine decarboxylase activator activity	ISS	molecular function
GO:0043085	positive regulation of catalytic activity	ISS	biological process
GO:0006596	polyamine biosynthetic process	IEA	biological process
GO:1902269	positive regulation of polyamine transmembrane transport	IEA	biological process
GO:0003824	catalytic activity	IEA	molecular function
GO:0042978	ornithine decarboxylase activator activity	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0006596	polyamine biosynthetic process	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0008792	arginine decarboxylase activity	TAS	molecular function
GO:0097055	agmatine biosynthetic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043085	positive regulation of catalytic activity	IEA	biological process
GO:0042978	ornithine decarboxylase activator activity	IEA	molecular function
GO:0033116	endoplasmic reticulum-Golgi intermediate compartment membrane	IEA	cellular component
GO:0006591	ornithine metabolic process	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:1902269	positive regulation of polyamine transmembrane transport	IEA	biological process
GO:0005801	cis-Golgi network	IEA	cellular component
GO:0005793	endoplasmic reticulum-Golgi intermediate compartment	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0043204	perikaryon	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0007283	spermatogenesis	NAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00330	Arginine and proline metabolism

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881