Home
Search

Simple

Advanced

Syndromes

Chromosomal defects

Infertility phenotypes

Highthroughput dataset
Browse

Genes

Proteins

SNPs

References

GO

Diseases

Pathways

Tools

Orthologs

SNPs

Motif scan

STRING

CDART
BLAST

BLASTN

BLASTP
Analysis

Panther

Function

GO

Pathways

Diseases
  Help
Statistics
   About Us

Search Result


Gene id 11345
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary
Gene Symbol GABARAPL2   Gene   UCSC   Ensembl
Aliases ATG8, ATG8C, GATE-16, GATE16, GEF-2, GEF2
Gene name GABA type A receptor associated protein like 2
Alternate names gamma-aminobutyric acid receptor-associated protein-like 2, GABA(A) receptor-associated protein-like 2, MAP1 light chain 3 related protein, ganglioside expression factor 2, general protein transport factor p16, golgi-associated ATPase enhancer of 16 kDa,
Gene location 16q23.1 (75566378: 75577880)     Exons: 4     NC_000016.10
OMIM 607452

Protein Summary
Protein general information P60520  

Name: Gamma aminobutyric acid receptor associated protein like 2 (GABA(A) receptor associated protein like 2) (Ganglioside expression factor 2) (GEF 2) (General protein transport factor p16) (Golgi associated ATPase enhancer of 16 kDa) (GATE 16) (MAP1 light cha

Length: 117  Mass: 13667

Tissue specificity: Ubiquitous. Expressed at high levels in the brain, heart, prostate, ovary, spleen and skeletal muscle. Expressed at very low levels in lung, thymus and small intestine. {ECO

Sequence MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKA
IFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF
Structural information
Interpro:  IPR004241  IPR029071  

PDB:  		 4CO7
PDBsum:   4CO7

DIP:  
35051
MINT:  
STRING:   ENSP00000037243
Other Databases GeneCards:  GABARAPL2  Malacards:  GABARAPL2

Gene ontology

Expand All | Collapse All
GO accessionTerm nameEvidence codeGo category
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0031625 ubiquitin protein ligase
binding
 IBA molecular function
GO:0008017 microtubule binding
 IBA molecular function
GO:0006995 cellular response to nitr
ogen starvation
 IBA biological process
GO:0005829 cytosol
 IBA cellular component
GO:0097352 autophagosome maturation
 IBA biological process
GO:0016236 macroautophagy
 IBA biological process
GO:0005776 autophagosome
 IBA cellular component
GO:0000422 autophagy of mitochondrio
n
 IBA biological process
GO:0000421 autophagosome membrane
 IBA cellular component
GO:0000045 autophagosome assembly
 IBA biological process
GO:0005776 autophagosome
 IDA cellular component
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0031410 cytoplasmic vesicle
 IEA cellular component
GO:0005794 Golgi apparatus
 IEA cellular component
GO:0006914 autophagy
 IEA biological process
GO:0015031 protein transport
 IEA biological process
GO:0000421 autophagosome membrane
 TAS cellular component
GO:0000421 autophagosome membrane
 TAS cellular component
GO:0016236 macroautophagy
 TAS biological process
GO:0097352 autophagosome maturation
 TAS biological process
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005622 intracellular
 IDA cellular component
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005794 Golgi apparatus
 IEA cellular component
GO:0000139 Golgi membrane
 IEA cellular component
GO:0005515 protein binding
 IPI molecular function
GO:0000139 Golgi membrane
 IDA cellular component
GO:0005737 cytoplasm
 IDA cellular component
GO:0005776 autophagosome
 IDA cellular component
GO:1901799 negative regulation of pr
oteasomal protein catabol
ic process
 IMP biological process
GO:0005776 autophagosome
 IEA cellular component
GO:0005794 Golgi apparatus
 IEA cellular component
GO:0005515 protein binding
 IPI molecular function
GO:0000421 autophagosome membrane
 IDA cellular component
GO:0051117 ATPase binding
 ISS molecular function
GO:0032781 positive regulation of AT
Pase activity
 ISS biological process
GO:0006914 autophagy
 NAS biological process
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005829 cytosol
 ISS cellular component
GO:0000139 Golgi membrane
 ISS cellular component
GO:0048487 beta-tubulin binding
 ISS molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0000149 SNARE binding
 ISS molecular function
GO:0050811 GABA receptor binding
 NAS molecular function
GO:0050811 GABA receptor binding
 ISS molecular function
GO:0008017 microtubule binding
 NAS molecular function
GO:0006891 intra-Golgi vesicle-media
ted transport
 ISS biological process
GO:0005794 Golgi apparatus
 ISS cellular component
GO:0000139 Golgi membrane
 ISS cellular component
GO:0031625 ubiquitin protein ligase
binding
 IPI molecular function

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa05131Shigellosis
hsa05167Kaposi sarcoma-associated herpesvirus infection
hsa04621NOD-like receptor signaling pathway
hsa04140Autophagy - animal
hsa04371Apelin signaling pathway
hsa04068FoxO signaling pathway
hsa04727GABAergic synapse
hsa04137Mitophagy - animal
hsa04136Autophagy - other

Diseases

Expand All | Collapse All
Associated diseases References
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All
PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia
19 (6 controls
, 13 cases)
 Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
 Show abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm
18
 Male infertility GSE26881
 Show abstract