• Gene id: 113419

Gene Summary

• Gene Symbol: TEX261   Gene   UCSC   Ensembl
• Aliases: TEG-261
• Gene name: testis expressed 261
• Alternate names: protein TEX261, testis expressed sequence 261,
• Gene location: 2p13.3 (70994872: 70985941)     Exons: 6     NC_000002.12
• OMIM: 618562

Protein Summary

• Protein general information: Q6UWH6  
  • Name: Protein TEX261
  • Length: 196  
  • Mass: 22538
• Sequence:

  MWFMYLLSWLSLFIQVAFITLAVAAGLYYLAELIEEYTVATSRIIKYMIWFSTAVLIGLYVFERFPTSMIGVGLF
  TNLVYFGLLQTFPFIMLTSPNFILSCGLVVVNHYLAFQFFAEEYYPFSEVLAYFTFCLWIIPFAFFVSLSAGENV
  LPSTMQPGDDVVSNYFTKGKRGKRLGILVVFSFIKEAILPSRQKIY

• Structural information:
  • Interpro: IPR007277  
  • STRING: ENSP00000272438
• Other Databases: GeneCards:  TEX261  Malacards:  TEX261

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030173	integral component of Golgi membrane	IBA	cellular component
GO:0030176	integral component of endoplasmic reticulum membrane	IBA	cellular component
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	IBA	biological process
GO:0030134	COPII-coated ER to Golgi transport vesicle	IBA	cellular component
GO:0097020	COPII adaptor activity	IBA	molecular function
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0097020	COPII adaptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881