• Gene id: 11341

Gene Summary

• Gene Symbol: SCRG1   Gene   UCSC   Ensembl
• Aliases: SCRG-1
• Gene name: stimulator of chondrogenesis 1
• Alternate names: scrapie-responsive protein 1, scrapie responsive gene 1, scrapie-responsive gene 1 protein,
• Gene location: 4q34.1 (36134900: 36146561)     Exons: 4     NC_000021.9
• Gene summary(Entrez): Scrapie-responsive gene 1 is associated with neurodegenerative changes observed in transmissible spongiform encephalopathies. It may play a role in host response to prion-associated infections. The scrapie responsive protein 1 may be partly included in th
• OMIM: 603163

Protein Summary

• Protein general information: O75711  
  • Name: Scrapie responsive protein 1 (Scrapie responsive gene 1 protein) (ScRG 1)
  • Length: 98  
  • Mass: 11081
  • Tissue specificity: Expressed abundantly in the central nervous system of adult, but not at all in fetal brain. High levels of SCRG1 transcripts are also observed in testis and aorta.
• Sequence:

  MKLMVLVFTIGLTLLLGVQAMPANRLSCYRKILKDHNCHNLPEGVADLTQIDVNVQDHFWDGKGCEMICYCNFSE
  LLCCPKDVFFGPKISFVIPCNNQ

• Structural information:
  • Interpro: IPR028063  
  • STRING: ENSP00000296506
• Other Databases: GeneCards:  SCRG1  Malacards:  SCRG1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0044306	neuron projection terminus	IBA	cellular component
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0007399	nervous system development	TAS	biological process
GO:0005615	extracellular space	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0044306	neuron projection terminus	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)