Home
Search

Simple

Advanced

Syndromes

Chromosomal defects

Infertility phenotypes

Highthroughput dataset
Browse

Genes

Proteins

SNPs

References

GO

Diseases

Pathways

Tools

Orthologs

SNPs

Motif scan

STRING

CDART
BLAST

BLASTN

BLASTP
Analysis

Panther

Function

GO

Pathways

Diseases
  Help
Statistics
   About Us

Search Result


Gene id 11340
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary
Gene Symbol EXOSC8   Gene   UCSC   Ensembl
Aliases CIP3, EAP2, OIP2, PCH1C, RRP43, Rrp43p, bA421P11.3, p9
Gene name exosome component 8
Alternate names exosome complex component RRP43, CBP-interacting protein 3, OIP-2, Opa interacting protein 2, exosome complex exonuclease RRP43, ribosomal RNA-processing protein 43,
Gene location 13q13.3 (37000372: 37009613)     Exons: 12     NC_000013.11
Gene summary(Entrez) This gene encodes a 3'-5' exoribonuclease that specifically interacts with mRNAs containing AU-rich elements. The encoded protein is part of the exosome complex that is important for the degradation of numerous RNA species. A pseudogene of this gene is fo
OMIM 606019

Protein Summary
Protein general information Q96B26  

Name: Exosome complex component RRP43 (Exosome component 8) (Opa interacting protein 2) (OIP 2) (Ribosomal RNA processing protein 43) (p9)

Length: 276  Mass: 30040

Sequence MAAGFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGVKAEFAAPSTDAPD
KGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKEDLCISPGKLVWVLYCDLICLDYDGNILD
ACTFALLAALKNVQLPEVTINEETALAEVNLKKKSYLNIRTHPVATSFAVFDDTLLIVDPTGEEEHLATGTLTIV
MDEEGKLCCLHKPGGSGLTGAKLQDCMSRAVTRHKEVKKLMDEVIKSMKPK
Structural information
Interpro:  IPR001247  IPR015847  IPR036345  IPR027408  IPR020568  
IPR033196  

PDB:  		 2NN6 6D6Q 6D6R 6H25
PDBsum:   2NN6 6D6Q 6D6R 6H25

DIP:  
31133
MINT:  
STRING:   ENSP00000374354
Other Databases GeneCards:  EXOSC8  Malacards:  EXOSC8

Gene ontology

Expand All | Collapse All
GO accessionTerm nameEvidence codeGo category
GO:0071038 nuclear polyadenylation-d
ependent tRNA catabolic p
rocess
 IBA biological process
GO:0071028 nuclear mRNA surveillance
 IBA biological process
GO:0043928 exonucleolytic catabolism
of deadenylated mRNA
 IBA biological process
GO:0034473 U1 snRNA 3'-end processin
g
 IBA biological process
GO:0034427 nuclear-transcribed mRNA
catabolic process, exonuc
leolytic, 3'-5'
 IBA biological process
GO:0017091 AU-rich element binding
 IBA molecular function
GO:0016075 rRNA catabolic process
 IBA biological process
GO:0071042 nuclear polyadenylation-d
ependent mRNA catabolic p
rocess
 IBA biological process
GO:0071035 nuclear polyadenylation-d
ependent rRNA catabolic p
rocess
 IBA biological process
GO:0034476 U5 snRNA 3'-end processin
g
 IBA biological process
GO:0034475 U4 snRNA 3'-end processin
g
 IBA biological process
GO:0000467 exonucleolytic trimming t
o generate mature 3'-end
of 5.8S rRNA from tricist
ronic rRNA transcript (SS
U-rRNA, 5.8S rRNA, LSU-rR
NA)
 IBA biological process
GO:0000177 cytoplasmic exosome (RNas
e complex)
 IBA cellular component
GO:0000176 nuclear exosome (RNase co
mplex)
 IBA cellular component
GO:0004532 exoribonuclease activity
 IDA NOT|molecular function
GO:0005737 cytoplasm
 IDA cellular component
GO:0005634 nucleus
 IDA cellular component
GO:0000178 exosome (RNase complex)
 IEA cellular component
GO:0006396 RNA processing
 IEA biological process
GO:0006401 RNA catabolic process
 IEA biological process
GO:0000178 exosome (RNase complex)
 IEA cellular component
GO:0005634 nucleus
 IEA cellular component
GO:0006364 rRNA processing
 IEA biological process
GO:0003723 RNA binding
 IEA molecular function
GO:0005737 cytoplasm
 IEA cellular component
GO:0006364 rRNA processing
 TAS biological process
GO:0043928 exonucleolytic catabolism
of deadenylated mRNA
 TAS biological process
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0043488 regulation of mRNA stabil
ity
 TAS biological process
GO:0043488 regulation of mRNA stabil
ity
 TAS biological process
GO:0043488 regulation of mRNA stabil
ity
 TAS biological process
GO:0042802 identical protein binding
 IPI molecular function
GO:0042802 identical protein binding
 IPI molecular function
GO:0042802 identical protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005730 nucleolus
 IEA cellular component
GO:0005737 cytoplasm
 IEA cellular component
GO:0005634 nucleus
 IEA cellular component
GO:0001650 fibrillar center
 IDA cellular component
GO:0005654 nucleoplasm
 IDA cellular component
GO:0043231 intracellular membrane-bo
unded organelle
 IDA cellular component
GO:0005829 cytosol
 IDA cellular component
GO:0035925 mRNA 3'-UTR AU-rich regio
n binding
 IDA molecular function
GO:0000178 exosome (RNase complex)
 IDA cellular component
GO:0008150 biological_process
 ND biological process

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa03018RNA degradation

Diseases

Expand All | Collapse All
Associated diseases References
Pontocerebellar hypoplasia KEGG:H00897
Pontocerebellar hypoplasia KEGG:H00897
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All
PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia
19 (6 controls
, 13 cases)
 Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
 Show abstract