• Gene id: 11338

Gene Summary

• Gene Symbol: U2AF2   Gene   UCSC   Ensembl
• Aliases: U2AF65
• Gene name: U2 small nuclear RNA auxiliary factor 2
• Alternate names: splicing factor U2AF 65 kDa subunit, U2 (RNU2) small nuclear RNA auxiliary factor 2, U2 auxiliary factor 65 kDa subunit, U2 small nuclear ribonucleoprotein auxiliary factor (65kD), U2 snRNP auxiliary factor large subunit, hU2AF65,
• Gene location: 19q13.42 (55654131: 55674715)     Exons: 14     NC_000019.10
• Gene summary(Entrez): U2 auxiliary factor (U2AF), comprised of a large and a small subunit, is a non-snRNP protein required for the binding of U2 snRNP to the pre-mRNA branch site. This gene encodes the U2AF large subunit which contains a sequence-specific RNA-binding region w
• OMIM: 118496

Protein Summary

• Protein general information: P26368  
  • Name: Splicing factor U2AF 65 kDa subunit (U2 auxiliary factor 65 kDa subunit) (hU2AF(65)) (hU2AF65) (U2 snRNP auxiliary factor large subunit)
  • Length: 475  
  • Mass: 53501
• Sequence:

  MSDFDEFERQLNENKQERDKENRHRKRSHSRSRSRDRKRRSRSRDRRNRDQRSASRDRRRRSKPLTRGAKEEHGG
  LIRSPRHEKKKKVRKYWDVPPPGFEHITPMQYKAMQAAGQIPATALLPTMTPDGLAVTPTPVPVVGSQMTRQARR
  LYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLK
  IRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSK
  GYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNATLVSPPSTINQTPVTLQVPGLMSSQVQMGGHPT
  EVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGVEVPGCGKIFVEFTSVFDCQKAMQGLT
  GRKFANRVVVTKYCDPDSYHRRDFW

• Structural information:
  • Protein Domains: (149..23-)
    (/note="RRM-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
    (259..33-)
    (/note="RRM-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
    (385..46-)
    (/note="RRM-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176"-)
  • Interpro: IPR012677  IPR035979  IPR000504  IPR006529  
  • Prosite: PS50102
  • PDB: 1JMT 1O0P 1OPI 1U2F 2G4B 2HZC 2M0G 2U2F 2YH0 2YH1 3VAF 3VAG 3VAH 3VAI 3VAJ 3VAK 3VAL 3VAM 4FXW 4TU7 4TU8 4TU9 5EV1 5EV2 5EV3 5EV4 5W0G 5W0H
  • PDBsum: 1JMT 1O0P 1OPI 1U2F 2G4B 2HZC 2M0G 2U2F 2YH0 2YH1 3VAF 3VAG 3VAH 3VAI 3VAJ 3VAK 3VAL 3VAM 4FXW 4TU7 4TU8 4TU9 5EV1 5EV2 5EV3 5EV4 5W0G 5W0H
  • DIP: 2154
  • STRING: ENSP00000307863
• Other Databases: GeneCards:  U2AF2  Malacards:  U2AF2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005681	spliceosomal complex	IDA	cellular component
GO:0000398	mRNA splicing, via spliceosome	IC	biological process
GO:0008187	poly-pyrimidine tract binding	IBA	molecular function
GO:0030628	pre-mRNA 3'-splice site binding	IBA	molecular function
GO:0000243	commitment complex	IBA	cellular component
GO:0016607	nuclear speck	IBA	cellular component
GO:0071004	U2-type prespliceosome	IBA	cellular component
GO:0089701	U2AF complex	IBA	cellular component
GO:0033120	positive regulation of RNA splicing	IDA	biological process
GO:0000974	Prp19 complex	IDA	colocalizes with
GO:0048025	negative regulation of mRNA splicing, via spliceosome	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006397	mRNA processing	IEA	biological process
GO:0005681	spliceosomal complex	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0006397	mRNA processing	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0008380	RNA splicing	IEA	biological process
GO:0006397	mRNA processing	TAS	biological process
GO:0016607	nuclear speck	IDA	cellular component
GO:0006406	mRNA export from nucleus	TAS	biological process
GO:0000398	mRNA splicing, via spliceosome	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006405	RNA export from nucleus	TAS	biological process
GO:0031124	mRNA 3'-end processing	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070742	C2H2 zinc finger domain binding	IEA	molecular function
GO:0008380	RNA splicing	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0031397	negative regulation of protein ubiquitination	IDA	biological process
GO:0031397	negative regulation of protein ubiquitination	IMP	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0030628	pre-mRNA 3'-splice site binding	IDA	molecular function
GO:0016607	nuclear speck	IDA	cellular component
GO:0071004	U2-type prespliceosome	IDA	cellular component
GO:0089701	U2AF complex	IDA	cellular component
GO:0089701	U2AF complex	IDA	cellular component
GO:0000398	mRNA splicing, via spliceosome	IDA	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03040	Spliceosome

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq