• Gene id: 11337

Gene Summary

• Gene Symbol: GABARAP   Gene   UCSC   Ensembl
• Aliases: ATG8A, GABARAP-a, MM46
• Gene name: GABA type A receptor-associated protein
• Alternate names: gamma-aminobutyric acid receptor-associated protein, GABA(A) receptor-associated protein, epididymis secretory sperm binding protein,
• Gene location: 17p13.1 (7242448: 7240007)     Exons: 4     NC_000017.11
• Gene summary(Entrez): Gamma-aminobutyric acid A receptors [GABA(A) receptors] are ligand-gated chloride channels that mediate inhibitory neurotransmission. This gene encodes GABA(A) receptor-associated protein, which is highly positively charged in its N-terminus and shares se
• OMIM: 605125

Protein Summary

• Protein general information: O95166  
  • Name: Gamma aminobutyric acid receptor associated protein (GABA(A) receptor associated protein) (MM46)
  • Length: 117  
  • Mass: 13918
  • Tissue specificity: Heart, brain, placenta, liver, skeletal muscle, kidney and pancreas. {ECO
• Sequence:

  MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDA
  LFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL

• Structural information:
  • Interpro: IPR004241  IPR029071  
  • PDB: 1GNU 1KLV 1KM7 1KOT 3D32 3DOW 3WIM 4XC2 5DPS 6HB9 6HOG 6HOH 6HOJ 6HOK 6HYL 6HYM 6HYN 6HYO
  • PDBsum: 1GNU 1KLV 1KM7 1KOT 3D32 3DOW 3WIM 4XC2 5DPS 6HB9 6HOG 6HOH 6HOJ 6HOK 6HYL 6HYM 6HYN 6HYO
  • DIP: 35050
  • STRING: ENSP00000306866
• Other Databases: GeneCards:  GABARAP  Malacards:  GABARAP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0006995	cellular response to nitrogen starvation	IBA	biological process
GO:0008017	microtubule binding	IBA	molecular function
GO:0031625	ubiquitin protein ligase binding	IBA	molecular function
GO:0050811	GABA receptor binding	IBA	molecular function
GO:0000045	autophagosome assembly	IBA	biological process
GO:0000421	autophagosome membrane	IBA	cellular component
GO:0000422	autophagy of mitochondrion	IBA	biological process
GO:0005776	autophagosome	IBA	cellular component
GO:0016236	macroautophagy	IBA	biological process
GO:0097352	autophagosome maturation	IBA	biological process
GO:0005776	autophagosome	IDA	cellular component
GO:0005930	axoneme	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0006914	autophagy	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006605	protein targeting	TAS	biological process
GO:0007268	chemical synaptic transmission	TAS	biological process
GO:0000421	autophagosome membrane	TAS	cellular component
GO:0000421	autophagosome membrane	TAS	cellular component
GO:0016236	macroautophagy	TAS	biological process
GO:0097352	autophagosome maturation	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0097225	sperm midpiece	IEA	cellular component
GO:0015629	actin cytoskeleton	IEA	cellular component
GO:0008017	microtubule binding	IEA	molecular function
GO:0005930	axoneme	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005790	smooth endoplasmic reticulum	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0050811	GABA receptor binding	IEA	molecular function
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0044297	cell body	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005875	microtubule associated complex	IEA	cellular component
GO:0000226	microtubule cytoskeleton organization	IEA	biological process
GO:0015031	protein transport	IEA	biological process
GO:0012505	endomembrane system	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005776	autophagosome	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045202	synapse	IEA	cellular component
GO:0008625	extrinsic apoptotic signaling pathway via death domain receptors	IDA	biological process
GO:0000421	autophagosome membrane	IDA	cellular component
GO:0048487	beta-tubulin binding	IDA	molecular function
GO:0050811	GABA receptor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05131	Shigellosis
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa04621	NOD-like receptor signaling pathway
hsa04140	Autophagy - animal
hsa04371	Apelin signaling pathway
hsa04068	FoxO signaling pathway
hsa04727	GABAergic synapse
hsa04137	Mitophagy - animal
hsa04136	Autophagy - other

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray