• Gene id: 11335

Gene Summary

• Gene Symbol: CBX3   Gene   UCSC   Ensembl
• Aliases: HECH, HP1-GAMMA, HP1Hs-gamma
• Gene name: chromobox 3
• Alternate names: chromobox protein homolog 3, HP1 gamma homolog, chromobox homolog 3 (HP1 gamma homolog, Drosophila), heterochromatin protein 1 homolog gamma, heterochromatin protein HP1 gamma, heterochromatin-like protein 1, modifier 2 protein,
• Gene location: 7p15.2 (26201442: 26213606)     Exons: 7     NC_000007.14
• Gene summary(Entrez): At the nuclear envelope, the nuclear lamina and heterochromatin are adjacent to the inner nuclear membrane. The protein encoded by this gene binds DNA and is a component of heterochromatin. This protein also can bind lamin B receptor, an integral membrane
• OMIM: 604477

Protein Summary

• Protein general information: Q13185  
  • Name: Chromobox protein homolog 3 (HECH) (Heterochromatin protein 1 homolog gamma) (HP1 gamma) (Modifier 2 protein)
  • Length: 183  
  • Mass: 20811
• Sequence:

  MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEA
  FLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADL
  VLAKEANMKCPQIVIAFYEERLTWHSCPEDEAQ

• Structural information:
  • Protein Domains: (30..8-)
    (/note="Chromo-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00053-)
    (121..17-)
    (/note="Chromo-)
    (subtype-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00053"-)
  • Interpro: IPR038033  IPR016197  IPR000953  IPR017984  IPR023780   IPR008251  IPR023779  
  • Prosite: PS00598 PS50013
  • PDB: 2L11 3DM1 3KUP 3TZD 5T1I
  • PDBsum: 2L11 3DM1 3KUP 3TZD 5T1I
  • DIP: 5985
  • STRING: ENSP00000336687
• Other Databases: GeneCards:  CBX3  Malacards:  CBX3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000775	chromosome, centromeric region	IDA	cellular component
GO:0019899	enzyme binding	IPI	molecular function
GO:0005635	nuclear envelope	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005719	nuclear euchromatin	IEA	cellular component
GO:0048511	rhythmic process	IEA	biological process
GO:0006325	chromatin organization	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0070317	negative regulation of G0 to G1 transition	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0035985	senescence-associated heterochromatin focus	IEA	cellular component
GO:0071549	cellular response to dexamethasone stimulus	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1990226	histone methyltransferase binding	IPI	molecular function
GO:0000784	nuclear chromosome, telomeric region	HDA	cellular component
GO:0045892	negative regulation of transcription, DNA-templated	IMP	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005720	nuclear heterochromatin	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0005819	spindle	IDA	cellular component
GO:0005719	nuclear euchromatin	IDA	cellular component
GO:0000785	chromatin	IDA	cellular component
GO:0019904	protein domain specific binding	IPI	molecular function
GO:0019904	protein domain specific binding	IPI	molecular function
GO:0006338	chromatin remodeling	NAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005637	nuclear inner membrane	NAS	cellular component
GO:0031618	nuclear pericentric heterochromatin	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000779	condensed chromosome, centromeric region	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0006974	cellular response to DNA damage stimulus	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0090734	site of DNA damage	IMP	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05131	Shigellosis

Diseases

Associated diseases	References
Prostate cancer	PMID:18436254
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881