• Gene id: 11334

Gene Summary

• Gene Symbol: TUSC2   Gene   UCSC   Ensembl
• Aliases: C3orf11, FUS1, PAP, PDAP2
• Gene name: tumor suppressor 2, mitochondrial calcium regulator
• Alternate names: tumor suppressor candidate 2, PDGFA-associated protein 2, fus-1 protein, fusion 1 protein,
• Gene location: 3p21.31 (50328237: 50324908)     Exons: 3     NC_000003.12
• Gene summary(Entrez): This gene is a highly conserved lung cancer candidate gene. No other information about this gene is currently available. [provided by RefSeq, Jul 2008]
• OMIM: 602414

Protein Summary

• Protein general information: O75896  
  • Name: Tumor suppressor candidate 2 (Fusion 1 protein) (Fus 1 protein) (PDGFA associated protein 2)
  • Length: 110  
  • Mass: 12074
  • Tissue specificity: Strong expression in heart, lung, skeletal muscle, kidney, and pancreas, followed by brain and liver, lowest levels in placenta.
• Sequence:

  MGASGSKARGLWPFASAAGGGGSEAAGAEQALVRPRGRAVPPFVFTRRGSMFYDEDGDLAHEFYEETIVTKNGQK
  RAKLRRVHKNLIPQGIVKLDHPRIHVDFPVILYEV

• Structural information:
  • Interpro: IPR029393  
  • STRING: ENSP00000232496
• Other Databases: GeneCards:  TUSC2  Malacards:  TUSC2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051881	regulation of mitochondrial membrane potential	IBA	biological process
GO:0006954	inflammatory response	IBA	biological process
GO:0005739	mitochondrion	IBA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006909	phagocytosis	IEA	biological process
GO:0032733	positive regulation of interleukin-10 production	IEA	biological process
GO:0071609	chemokine (C-C motif) ligand 5 production	IEA	biological process
GO:0001779	natural killer cell differentiation	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0006954	inflammatory response	IEA	biological process
GO:0032618	interleukin-15 production	IEA	biological process
GO:0032700	negative regulation of interleukin-17 production	IEA	biological process
GO:0048469	cell maturation	IEA	biological process
GO:0050829	defense response to Gram-negative bacterium	IEA	biological process
GO:0051881	regulation of mitochondrial membrane potential	IEA	biological process
GO:0070945	neutrophil-mediated killing of gram-negative bacterium	IEA	biological process
GO:2000377	regulation of reactive oxygen species metabolic process	IEA	biological process
GO:0051881	regulation of mitochondrial membrane potential	IBA	biological process
GO:0006954	inflammatory response	IBA	biological process
GO:0005739	mitochondrion	IBA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006909	phagocytosis	IEA	biological process
GO:0032733	positive regulation of interleukin-10 production	IEA	biological process
GO:0071609	chemokine (C-C motif) ligand 5 production	IEA	biological process
GO:0001779	natural killer cell differentiation	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0006954	inflammatory response	IEA	biological process
GO:0032618	interleukin-15 production	IEA	biological process
GO:0032700	negative regulation of interleukin-17 production	IEA	biological process
GO:0048469	cell maturation	IEA	biological process
GO:0050829	defense response to Gram-negative bacterium	IEA	biological process
GO:0051881	regulation of mitochondrial membrane potential	IEA	biological process
GO:0070945	neutrophil-mediated killing of gram-negative bacterium	IEA	biological process
GO:2000377	regulation of reactive oxygen species metabolic process	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Associated with spermatogenesis and epigenetic regulation	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Associated with spermatogenesis and epigenetic regulation			18	Male infertility	GSE26881
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881