• Gene id: 11333

Gene Summary

• Gene Symbol: PDAP1   Gene   UCSC   Ensembl
• Aliases: HASPP28, PAP, PAP1
• Gene name: PDGFA associated protein 1
• Alternate names: 28 kDa heat- and acid-stable phosphoprotein, PDGF-associated protein,
• Gene location: 7q22.1 (99408596: 99394672)     Exons: 6     NC_000007.14
• Gene summary(Entrez): The protein encoded by this gene is a phosphoprotein that may upregulate the PDGFA-stimulated growth of fibroblasts and also downregulate the mitogenicity of PDGFB. The encoded protein in rodents has been shown to bind PDGFA with a low affinity. [provided
• OMIM: 603407

Protein Summary

• Protein general information: Q13442  
  • Name: 28 kDa heat and acid stable phosphoprotein (PDGF associated protein) (PAP) (PDGFA associated protein 1) (PAP1)
  • Length: 181  
  • Mass: 20630
• Sequence:

  MPKGGRKGGHKGRARQYTSPEEIDAQLQAEKQKAREEEEQKEGGDGAAGDPKKEKKSLDSDESEDEEDDYQQKRK
  GVEGLIDIENPNRVAQTTKKVTQLDLDGPKELSRREREEIEKQKAKERYMKMHLAGKTEQAKADLARLAIIRKQR
  EEAARKKEEERKAKDDATLSGKRMQSLSLNK

• Structural information:
  • Interpro: IPR019380  IPR039876  
  • STRING: ENSP00000222968
• Other Databases: GeneCards:  PDAP1  Malacards:  PDAP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005829	cytosol	IBA	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0043312	neutrophil degranulation	TAS	biological process
GO:1904813	ficolin-1-rich granule lumen	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Malignant glioma	PMID:27448842
Cryptorchidism	MIK: 28606200
Male factor infertility	MIK: 29961538

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
29961538	Male factor infertility			318 (128 couples presenting with OAT (MF) and 118 maternal age-matched control (no MF) subjects undergoing infertility treatment, 72 surplus cryopreserved blastocysts)	Male infertility	RNA-seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq