• Gene id: 11331

Gene Summary

• Gene Symbol: PHB2   Gene   UCSC   Ensembl
• Aliases: BAP, BCAP37, Bap37, PNAS-141, REA, hBAP, p22
• Gene name: prohibitin 2
• Alternate names: prohibitin-2, B-cell associated protein, B-cell receptor-associated protein BAP37, D-prohibitin, repressor of estrogen receptor activity,
• Gene location: 12p13.31 (6970752: 6965326)     Exons: 10     NC_000012.12
• OMIM: 610704

Protein Summary

• Protein general information: Q99623  
  • Name: Prohibitin 2 (B cell receptor associated protein BAP37) (D prohibitin) (Repressor of estrogen receptor activity)
  • Length: 299  
  • Mass: 33296
• Sequence:

  MAQNLKDLAGRLPAGPRGMGTALKLLLGAGAVAYGVRESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWF
  QYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNA
  SQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKI
  VQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK

• Structural information:
  • Interpro: IPR001107  IPR036013  IPR000163  
  • CDD: cd03401
  • PDB: 6IQE
  • PDBsum: 6IQE
  • STRING: ENSP00000441875
• Other Databases: GeneCards:  PHB2  Malacards:  PHB2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0046625	sphingolipid binding	IDA	molecular function
GO:0005743	mitochondrial inner membrane	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0035632	mitochondrial prohibitin complex	IDA	cellular component
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0039529	RIG-I signaling pathway	IDA	biological process
GO:0000423	mitophagy	IDA	biological process
GO:0000187	activation of MAPK activity	IDA	NOT|biological process
GO:0016477	cell migration	IDA	biological process
GO:0032991	protein-containing complex	IDA	cellular component
GO:0016363	nuclear matrix	IDA	cellular component
GO:0140374	antiviral innate immune response	IDA	biological process
GO:0005743	mitochondrial inner membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:1904959	regulation of cytochrome-c oxidase activity	IMP	biological process
GO:1900208	regulation of cardiolipin metabolic process	ISS	biological process
GO:1990051	activation of protein kinase C activity	ISS	biological process
GO:0023035	CD40 signaling pathway	ISS	biological process
GO:0007202	activation of phospholipase C activity	ISS	biological process
GO:0002377	immunoglobulin production	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1901224	positive regulation of NIK/NF-kappaB signaling	ISS	biological process
GO:0042113	B cell activation	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0046982	protein heterodimerization activity	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0039520	induction by virus of host autophagy	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0006851	mitochondrial calcium ion transmembrane transport	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0098982	GABA-ergic synapse	IEA	cellular component
GO:0071300	cellular response to retinoic acid	IEA	biological process
GO:0048786	presynaptic active zone	IEA	cellular component
GO:0014069	postsynaptic density	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0060762	regulation of branching involved in mammary gland duct morphogenesis	IEA	biological process
GO:0060749	mammary gland alveolus development	IEA	biological process
GO:0046625	sphingolipid binding	IEA	molecular function
GO:0033600	negative regulation of mammary gland epithelial cell proliferation	IEA	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0071456	cellular response to hypoxia	IEA	biological process
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0030424	axon	IEA	cellular component
GO:0009611	response to wounding	IEA	biological process
GO:1904959	regulation of cytochrome-c oxidase activity	IEA	biological process
GO:0060744	mammary gland branching involved in thelarche	IEA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0033147	negative regulation of intracellular estrogen receptor signaling pathway	IEA	biological process
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0030449	regulation of complement activation	IDA	NOT|biological process
GO:0051091	positive regulation of DNA-binding transcription factor activity	IDA	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0071944	cell periphery	IDA	cellular component
GO:0007062	sister chromatid cohesion	IDA	biological process
GO:0005741	mitochondrial outer membrane	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0006606	protein import into nucleus	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005739	mitochondrion	HDA	cellular component
GO:0030331	estrogen receptor binding	NAS	molecular function
GO:0005743	mitochondrial inner membrane	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	HDA	cellular component
GO:0005634	nucleus	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0007005	mitochondrion organization	IMP	biological process
GO:0050821	protein stabilization	IMP	biological process
GO:0033218	amide binding	IPI	molecular function
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0008022	protein C-terminus binding	IPI	molecular function
GO:1902808	positive regulation of cell cycle G1/S phase transition	IMP	biological process
GO:0043433	negative regulation of DNA-binding transcription factor activity	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0047485	protein N-terminus binding	IPI	molecular function
GO:0031536	positive regulation of exit from mitosis	IMP	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq