• Gene id: 11329

Gene Summary

• Gene Symbol: STK38   Gene   UCSC   Ensembl
• Aliases: NDR, NDR1
• Gene name: serine/threonine kinase 38
• Alternate names: serine/threonine-protein kinase 38, NDR1 protein kinase, Ndr Ser/Thr kinase-like protein, nuclear Dbf2-related kinase 1,
• Gene location: 6p21.31 (86838999: 85955666)     Exons: 19     NC_000012.12
• Gene summary(Entrez): This gene encodes a member of the AGC serine/threonine kinase family of proteins. The kinase activity of this protein is regulated by autophosphorylation and phosphorylation by other upstream kinases. This protein has been shown to function in the cell cy
• OMIM: 606964

Protein Summary

• Protein general information: Q15208  
  • Name: Serine/threonine protein kinase 38 (EC 2.7.11.1) (NDR1 protein kinase) (Nuclear Dbf2 related kinase 1)
  • Length: 465  
  • Mass: 54190
  • Tissue specificity: Ubiquitously expressed with highest levels observed in peripheral blood leukocytes. {ECO
• Sequence:

  MAMTGSTPCSSMSNHTKERVTMTKVTLENFYSNLIAQHEEREMRQKKLEKVMEEEGLKDEEKRLRRSAHARKETE
  FLRLKRTRLGLEDFESLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVGHIRAERDILVEADSLWVV
  KMFYSFQDKLNLYLIMEFLPGGDMMTLLMKKDTLTEEETQFYIAETVLAIDSIHQLGFIHRDIKPDNLLLDSKGH
  VKLSDFGLCTGLKKAHRTEFYRNLNHSLPSDFTFQNMNSKRKAETWKRNRRQLAFSTVGTPDYIAPEVFMQTGYN
  KLCDWWSLGVIMYEMLIGYPPFCSETPQETYKKVMNWKETLTFPPEVPISEKAKDLILRFCCEWEHRIGAPGVEE
  IKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESDILKPTVATSNHPETDYKNKDWVFINYTYKRFEG
  LTARGAIPSYMKAAK

• Structural information:
  • Protein Domains: (89..38-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159,-ECO:0000312|EMBL:CAA84485.1)
    (383..45-)
    (/note="AGC-kinase-C-terminal")
  • Interpro: IPR000961  IPR011009  IPR017892  IPR000719  IPR017441   IPR008271  
  • Prosite: PS51285 PS00107 PS50011 PS00108
  • PDB: 1PSB 6BXI
  • PDBsum: 1PSB 6BXI
  • STRING: ENSP00000229812
• Other Databases: GeneCards:  STK38  Malacards:  STK38

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0018105	peptidyl-serine phosphorylation	IBA	biological process
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0031435	mitogen-activated protein kinase kinase kinase binding	IPI	molecular function
GO:0031435	mitogen-activated protein kinase kinase kinase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0006464	cellular protein modification process	IDA	biological process
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045296	cadherin binding	HDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0000287	magnesium ion binding	IDA	molecular function
GO:0043407	negative regulation of MAP kinase activity	IDA	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0005524	ATP binding	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0035556	intracellular signal transduction	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)