• Gene id: 113277

Gene Summary

• Gene Symbol: TMEM106A   Gene   UCSC   Ensembl
• Gene name: transmembrane protein 106A
• Alternate names: transmembrane protein 106A,
• Gene location: 17q21.31 (43211874: 43220040)     Exons: 9     NC_000017.11
• OMIM: 0

Protein Summary

• Protein general information: Q96A25  
  • Name: Transmembrane protein 106A
  • Length: 262  
  • Mass: 28920
  • Tissue specificity: Expressed in renal cells (at protein level) (PubMed
• Sequence:

  MGKTFSQLGSWREDENKSILSSKPAIGSKAVNYSSTGSSKSFCSCVPCEGTADASFVTCPTCQGSGKIPQELEKQ
  LVALIPYGDQRLKPKHTKLFVFLAVLICLVTSSFIVFFLFPRSVIVQPAGLNSSTVAFDEADIYLNITNILNISN
  GNYYPIMVTQLTLEVLHLSLVVGQVSNNLLLHIGPLASEQMFYAVATKIRDENTYKICTWLEIKVHHVLLHIQGT
  LTCSYLSHSEQLVFQSYEYVDCRGNASVPHQLTPHPP

• Structural information:
  • Interpro: IPR009790  
  • STRING: ENSP00000483246
• Other Databases: GeneCards:  TMEM106A  Malacards:  TMEM106A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1904407	positive regulation of nitric oxide metabolic process	ISS	biological process
GO:0050702	interleukin-1 beta secretion	ISS	biological process
GO:0045348	positive regulation of MHC class II biosynthetic process	ISS	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	ISS	biological process
GO:0035781	CD86 biosynthetic process	ISS	biological process
GO:0035780	CD80 biosynthetic process	ISS	biological process
GO:0005886	plasma membrane	ISS	cellular component
GO:1990774	tumor necrosis factor secretion	ISS	biological process
GO:0072604	interleukin-6 secretion	ISS	biological process
GO:0043410	positive regulation of MAPK cascade	ISS	biological process
GO:0042116	macrophage activation	ISS	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0035780	CD80 biosynthetic process	IEA	biological process
GO:0035781	CD86 biosynthetic process	IEA	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IEA	biological process
GO:0045348	positive regulation of MHC class II biosynthetic process	IEA	biological process
GO:0050702	interleukin-1 beta secretion	IEA	biological process
GO:1904407	positive regulation of nitric oxide metabolic process	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0042116	macrophage activation	IEA	biological process
GO:0043410	positive regulation of MAPK cascade	IEA	biological process
GO:0072604	interleukin-6 secretion	IEA	biological process
GO:1990774	tumor necrosis factor secretion	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0008150	biological_process	ND	biological process
GO:0003674	molecular_function	ND	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray