• Gene id: 113263

Gene Summary

• Gene Symbol: GLCCI1   Gene   UCSC   Ensembl
• Aliases: FAM117C, GCTR, GIG18, TSSN1
• Gene name: glucocorticoid induced 1
• Alternate names: glucocorticoid-induced transcript 1 protein, glucocorticoid induced transcript 1,
• Gene location: 7p21.3 (14724307: 14715081)     Exons: 3     NC_000009.12
• Gene summary(Entrez): This gene encodes a protein of unknown function. Expression of this gene is induced by glucocorticoids and may be an early marker for glucocorticoid-induced apoptosis. Single nucleotide polymorphisms in this gene are associated with a decreased response t
• OMIM: 614283

Protein Summary

• Protein general information: Q86VQ1  
  • Name: Glucocorticoid induced transcript 1 protein
  • Length: 547  
  • Mass: 58024
  • Tissue specificity: Predominantly expressed in lung, spleen, thymus and testis and, at lower levels, in brain, bone marrow, peripheral leukocytes, skin and trachea. {ECO
• Sequence:

  MSTASSSSSSSSSQTPHPPSQRMRRSAAGSPPAVAAAGSGNGAGGGGGVGCAPAAGAGRLLQPIRATVPYQLLRG
  SQHSPTRPPVAAAAASLGSLPGPGAARGPSPSSPTPPAAAAPAEQAPRAKGRPRRSPESHRRSSSPERRSPGSPV
  CRADKAKSQQVRTSSTIRRTSSLDTITGPYLTGQWPRDPHVHYPSCMKDKATQTPSCWAEEGAEKRSHQRSASWG
  SADQLKEQIAKLRQQLQRSKQSSRHSKEKDRQSPLHGNHITISHTQATGSRSVPMPLSNISVPKSSVSRVPCNVE
  GISPELEKVFIKENNGKEEVSKPLDIPDGRRAPLPAHYRSSSTRSIDTQTPSVQERSSSCSSHSPCVSPFCPPES
  QDGSPCSTEDLLYDRDKDSGSSSPLPKYASSPKPNNSYMFKREPPEGCERVKVFEEMASRQPISAPLFSCPDKNK
  VNFIPTGSAFCPVKLLGPLLPASDLMLKNSPNSGQSSALATLTVEQLSSRVSFTSLSDDTSTAGSMEASVQQPSQ
  QQQLLQELQGEDHISAQNYVII

• Structural information:
  • Interpro: IPR026639  IPR026642  
  • STRING: ENSP00000223145
• Other Databases: GeneCards:  GLCCI1  Malacards:  GLCCI1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray