• Gene id: 11320

Gene Summary

• Gene Symbol: MGAT4A   Gene   UCSC   Ensembl
• Aliases: GNT-IV, GNT-IVA, GnT-4a
• Gene name: alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A
• Alternate names: alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A, N-acetylglucosaminyltransferase IVa, N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase IVa, UDP-GlcNAc:a-1,3-D-mannoside b-1,4-acetylglucosaminyltransferase IV, UD,
• Gene location: 2q11.2 (36605410: 36534490)     Exons: 14     NC_000019.10
• Gene summary(Entrez): This gene encodes a key glycosyltransferase that regulates the formation of tri- and multiantennary branching structures in the Golgi apparatus. The encoded protein, in addition to the related isoenzyme B, catalyzes the transfer of N-acetylglucosamine (Gl
• OMIM: 604623

Protein Summary

• Protein general information: Q9UM21  
  • Name: Alpha 1,3 mannosyl glycoprotein 4 beta N acetylglucosaminyltransferase A (EC 2.4.1.145) (N glycosyl oligosaccharide glycoprotein N acetylglucosaminyltransferase IVa) (GlcNAc T IVa) (GnT IVa) (N acetylglucosaminyltransferase IVa) (UDP N acetylglucosamine:
  • Length: 535  
  • Mass: 61544
  • Tissue specificity: Expressed in pancreas, spleen, thymus, prostate, small intestine, peripheral blood leukocytes and lymph node. Strongly overexpressed in choriocarcinoma cancer cell lines. Down-regulated in pancreatic cancer. {ECO
• Sequence:

  MRLRNGTVATALAFITSFLTLSWYTTWQNGKEKLIAYQREFLALKERLRIAEHRISQRSSELNTIVQQFKRVGAE
  TNGSKDALNKFSDNTLKLLKELTSKKSLQVPSIYYHLPHLLKNEGSLQPAVQIGNGRTGVSIVMGIPTVKREVKS
  YLIETLHSLIDNLYPEEKLDCVIVVFIGETDIDYVHGVVANLEKEFSKEISSGLVEVISPPESYYPDLTNLKETF
  GDSKERVRWRTKQNLDYCFLMMYAQEKGIYYIQLEDDIIVKQNYFNTIKNFALQLSSEEWMILEFSQLGFIGKMF
  QAPDLTLIVEFIFMFYKEKPIDWLLDHILWVKVCNPEKDAKHCDRQKANLRIRFRPSLFQHVGLHSSLSGKIQKL
  TDKDYMKPLLLKIHVNPPAEVSTSLKVYQGHTLEKTYMGEDFFWAITPIAGDYILFKFDKPVNVESYLFHSGNQE
  HPGDILLNTTVEVLPFKSEGLEISKETKDKRLEDGYFRIGKFENGVAEGMVDPSLNPISAFRLSVIQNSAVWAIL
  NEIHIKKATN

• Structural information:
  • Interpro: IPR006759  
  • STRING: ENSP00000264968
• Other Databases: GeneCards:  MGAT4A  Malacards:  MGAT4A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0005793	endoplasmic reticulum-Golgi intermediate compartment	IBA	cellular component
GO:0005795	Golgi stack	IBA	cellular component
GO:0008375	acetylglucosaminyltransferase activity	IBA	molecular function
GO:0006487	protein N-linked glycosylation	IBA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0008454	alpha-1,3-mannosylglycoprotein 4-beta-N-acetylglucosaminyltransferase activity	TAS	molecular function
GO:0006491	N-glycan processing	TAS	biological process
GO:0008454	alpha-1,3-mannosylglycoprotein 4-beta-N-acetylglucosaminyltransferase activity	IEA	molecular function
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0000139	Golgi membrane	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0008375	acetylglucosaminyltransferase activity	IEA	molecular function
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0006487	protein N-linked glycosylation	IEA	biological process
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0006486	protein glycosylation	IEA	biological process
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00510	N-Glycan biosynthesis
hsa00513	Various types of N-glycan biosynthesis

Diseases

Associated diseases	References
pancreatic cancer	PMID:16434023
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)