• Gene id: 11319

Gene Summary

• Gene Symbol: ECD   Gene   UCSC   Ensembl
• Aliases: GCR2, HSGT1, SGT1
• Gene name: ecdysoneless cell cycle regulator
• Alternate names: protein ecdysoneless homolog, ecdysoneless homolog, human suppressor of GCR two, protein SGT1, suppressor of GCR2, suppressor of S. cerevisiae gcr2,
• Gene location: 10q22.2 (24256334: 24362411)     Exons: 4     NC_000016.10
• OMIM: 616464

Protein Summary

• Protein general information: O95905  
  • Name: Protein ecdysoneless homolog (Human suppressor of GCR two) (hSGT1)
  • Length: 644  
  • Mass: 72758
  • Tissue specificity: Highly expressed in muscle and heart. Over-expressed in pancreatic and breast cancers. {ECO
• Sequence:

  MEETMKLATMEDTVEYCLFLIPDESRDSDKHKEILQKYIERIITRFAPMLVPYIWQNQPFNLKYKPGKGGVPAHM
  FGVTKFGDNIEDEWFIVYVIKQITKEFPELVARIEDNDGEFLLIEAADFLPKWLDPENSTNRVFFCHGELCIIPA
  PRKSGAESWLPTTPPTIPQALNIITAHSEKILASESIRAAVNRRIRGYPEKIQASLHRAHCFLPAGIVAVLKQRP
  RLVAAAVQAFYLRDPIDLRACRVFKTFLPETRIMTSVTFTKCLYAQLVQQRFVPDRRSGYRLPPPSDPQYRAHEL
  GMKLAHGFEILCSKCSPHFSDCKKSLVTASPLWASFLESLKKNDYFKGLIEGSAQYRERLEMAENYFQLSVDWPE
  SSLAMSPGEEILTLLQTIPFDIEDLKKEAANLPPEDDDQWLDLSPDQLDQLLQEAVGKKESESVSKEEKEQNYDL
  TEVSESMKAFISKVSTHKGAELPREPSEAPITFDADSFLNYFDKILGPRPNESDSDDLDDEDFECLDSDDDLDFE
  THEPGEEASLKGTLDNLKSYMAQMDQELAHTCISKSFTTRNQVEPVSQTTDNNSDEEDSGTGESVMAPVDVDLNL
  VSNILESYSSQAGLAGPASNLLQSMGVQLPDNTDHRPTSKPTKN

• Structural information:
  • Interpro: IPR010770  
  • STRING: ENSP00000401566
• Other Databases: GeneCards:  ECD  Malacards:  ECD

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0035035	histone acetyltransferase binding	IDA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0006397	mRNA processing	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0008380	RNA splicing	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008283	cell population proliferation	IEA	biological process
GO:2000045	regulation of G1/S transition of mitotic cell cycle	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)