• Gene id: 113178

Gene Summary

• Gene Symbol: SCAMP4   Gene   UCSC   Ensembl
• Aliases: SCAMP-4
• Gene name: secretory carrier membrane protein 4
• Alternate names: secretory carrier-associated membrane protein 4,
• Gene location: 19p13.3 (1905398: 1926012)     Exons: 7     NC_000019.10
• Gene summary(Entrez): Secretory carrier membrane proteins (SCAMPs) are widely distributed integral membrane proteins implicated in membrane trafficking. Most SCAMPs (e.g., SCAMP1; MIM 606911) have N-terminal cytoplasmic NPF (arg-pro-phe) repeats, 4 central transmembrane region
• OMIM: 191318

Protein Summary

• Protein general information: Q969E2  
  • Name: Secretory carrier associated membrane protein 4 (Secretory carrier membrane protein 4)
  • Length: 229  
  • Mass: 25728
• Sequence:

  MSEKENNFPPLPKFIPVKPCFYQNFSDEIPVEHQVLVKRIYRLWMFYCATLGVNLIACLAWWIGGGSGTNFGLAF
  VWLLLFTPCGYVCWFRPVYKAFRADSSFNFMAFFFIFGAQFVLTVIQAIGFSGWGACGWLSAIGFFQYSPGAAVV
  MLLPAIMFSVSAAMMAIAIMKVHRIYRGAGGSFQKAQTEWNTGTWRNPPSREAQYNNFSGNSLPEYPTVPSYPGS
  GQWP

• Structural information:
  • Interpro: IPR007273  
  • STRING: ENSP00000316007
• Other Databases: GeneCards:  SCAMP4  Malacards:  SCAMP4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0055038	recycling endosome membrane	IBA	cellular component
GO:0032588	trans-Golgi network membrane	IBA	cellular component
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0000139	Golgi membrane	IBA	cellular component
GO:0015031	protein transport	IBA	biological process
GO:0015031	protein transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq