• Gene id: 11315

Gene Summary

• Gene Symbol: PARK7   Gene   UCSC   Ensembl
• Aliases: DJ-1, DJ1, GATD2, HEL-S-67p
• Gene name: Parkinsonism associated deglycase
• Alternate names: protein/nucleic acid deglycase DJ-1, Parkinson disease (autosomal recessive, early onset) 7, epididymis secretory sperm binding protein Li 67p, maillard deglycase, oncogene DJ1, parkinson protein 7, protein DJ-1, protein deglycase DJ-1,
• Gene location: 1p36.23 (38468833: 38411137)     Exons: 24     NC_000008.11
• Gene summary(Entrez): The product of this gene belongs to the peptidase C56 family of proteins. It acts as a positive regulator of androgen receptor-dependent transcription. It may also function as a redox-sensitive chaperone, as a sensor for oxidative stress, and it apparentl
• OMIM: 602533

Protein Summary

• Protein general information: Q99497  
  • Name: Protein/nucleic acid deglycase DJ 1 (EC 3.1.2. ) (EC 3.5.1. ) (EC 3.5.1.124) (Maillard deglycase) (Oncogene DJ1) (Parkinson disease protein 7) (Parkinsonism associated deglycase) (Protein DJ 1) (DJ 1)
  • Length: 189  
  • Mass: 19,891
• Sequence:

  MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGG
  NLGAQNLSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDKMMNGGHYTYSENRVEKDG
  LILTSRGPGTSFEFALAIVEALNGKEVAAQVKAPLVLKD

• Structural information:
  • Interpro: IPR029062  IPR006287  IPR002818  
  • PDB: 1J42 1P5F 1PDV 1PDW 1PE0 1Q2U 1SOA 1UCF 2OR3 2R1T 2R1U 2R1V 2RK3 2RK4 2RK6 3B36 3B38 3B3A 3BWE 3CY6 3CYF 3CZ9 3CZA 3EZG 3F71 3SF8 4BTE 4MNT 4MTC 4N0M 4N12 4OGF 4OQ4 4P2G 4P34 4P35 4P36 4RKW 4RKY 4S0Z 4ZGG 5IP5 5SY6 5SY9 5SYA
  • PDBsum: 1J42 1P5F 1PDV 1PDW 1PE0 1Q2U 1SOA 1UCF 2OR3 2R1T 2R1U 2R1V 2RK3 2RK4 2RK6 3B36 3B38 3B3A 3BWE 3CY6 3CYF 3CZ9 3CZA 3EZG 3F71 3SF8 4BTE 4MNT 4MTC 4N0M 4N12 4OGF 4OQ4 4P2G 4P34 4P35 4P36 4RKW 4RKY 4S0Z 4ZGG 5IP5 5SY6 5SY9 5SYA
  • DIP: 35515
  • STRING: ENSP00000340278
• Other Databases: GeneCards:  PARK7  Malacards:  PARK7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000785	chromatin	IDA	cellular component
GO:0001933	negative regulation of protein phosphorylation	IGI	biological process
GO:0003713	transcription coactivator activity	IGI	molecular function
GO:0003713	transcription coactivator activity	TAS	molecular function
GO:0003729	mRNA binding	IDA	molecular function
GO:0005102	receptor binding	IPI	molecular function
GO:0005507	copper ion binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IMP	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005758	mitochondrial intermembrane space	IEA	cellular component
GO:0005759	mitochondrial matrix	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IMP	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006469	negative regulation of protein kinase activity	IGI	biological process
GO:0006508	proteolysis	IEA	biological process
GO:0006517	protein deglycosylation	IDA	biological process
GO:0006914	autophagy	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0007005	mitochondrion organization	ISS	biological process
GO:0007265	Ras protein signal transduction	TAS	biological process
GO:0007338	single fertilization	IEA	biological process
GO:0008134	transcription factor binding	IPI	molecular function
GO:0008233	peptidase activity	IDA	molecular function
GO:0008344	adult locomotory behavior	IEA	biological process
GO:0010273	detoxification of copper ion	IMP	biological process
GO:0010628	positive regulation of gene expression	TAS	biological process
GO:0010629	negative regulation of gene expression	IDA	biological process
GO:0016532	superoxide dismutase copper chaperone activity	IDA	molecular function
GO:0016605	PML body	IDA	cellular component
GO:0016684	oxidoreductase activity, acting on peroxide as acceptor	IDA	molecular function
GO:0018323	enzyme active site formation via L-cysteine sulfinic acid	IEA	biological process
GO:0019172	glyoxalase III activity	IDA	molecular function
GO:0019243	methylglyoxal catabolic process to D-lactate via S-lactoyl-glutathione	IDA	biological process
GO:0019249	lactate biosynthetic process	IEA	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0019900	kinase binding	IPI	molecular function
GO:0019955	cytokine binding	IPI	molecular function
GO:0030424	axon	ISS	cellular component
GO:0031397	negative regulation of protein ubiquitination	IDA	biological process
GO:0031397	negative regulation of protein ubiquitination	IDA	biological process
GO:0032091	negative regulation of protein binding	IDA	biological process
GO:0032091	negative regulation of protein binding	IGI	biological process
GO:0032091	negative regulation of protein binding	IDA	biological process
GO:0032091	negative regulation of protein binding	IDA	biological process
GO:0032091	negative regulation of protein binding	IMP	biological process
GO:0032091	negative regulation of protein binding	IDA	biological process
GO:0032148	activation of protein kinase B activity	IC	biological process
GO:0032435	negative regulation of proteasomal ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0032757	positive regulation of interleukin-8 production	IDA	biological process
GO:0033138	positive regulation of peptidyl-serine phosphorylation	IMP	biological process
GO:0033234	negative regulation of protein sumoylation	IDA	biological process
GO:0034599	cellular response to oxidative stress	IDA	biological process
GO:0034599	cellular response to oxidative stress	IDA	biological process
GO:0034599	cellular response to oxidative stress	IDA	biological process
GO:0034599	cellular response to oxidative stress	IDA	biological process
GO:0034599	cellular response to oxidative stress	IMP	biological process
GO:0036470	tyrosine 3-monooxygenase activator activity	IDA	molecular function
GO:0036471	cellular response to glyoxal	IDA	biological process
GO:0036478	L-dopa decarboxylase activator activity	IDA	molecular function
GO:0042493	response to drug	IEA	biological process
GO:0042743	hydrogen peroxide metabolic process	IDA	biological process
GO:0042743	hydrogen peroxide metabolic process	IDA	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0043066	negative regulation of apoptotic process	IDA	biological process
GO:0043523	regulation of neuron apoptotic process	IDA	biological process
GO:0043523	regulation of neuron apoptotic process	IDA	biological process
GO:0043524	negative regulation of neuron apoptotic process	IDA	biological process
GO:0044297	cell body	IEA	cellular component
GO:0044388	small protein activating enzyme binding	IPI	molecular function
GO:0044390	ubiquitin-like protein conjugating enzyme binding	IPI	molecular function
GO:0045121	membrane raft	IEA	cellular component
GO:0045340	mercury ion binding	IDA	molecular function
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IGI	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IMP	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IGI	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IMP	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IMP	biological process
GO:0046295	glycolate biosynthetic process	IDA	biological process
GO:0046826	negative regulation of protein export from nucleus	IGI	biological process
GO:0050681	androgen receptor binding	IPI	molecular function
GO:0050727	regulation of inflammatory response	ISS	biological process
GO:0050787	detoxification of mercury ion	IMP	biological process
GO:0050821	protein stabilization	IMP	biological process
GO:0050821	protein stabilization	IMP	biological process
GO:0050821	protein stabilization	IMP	biological process
GO:0050821	protein stabilization	IDA	biological process
GO:0051091	positive regulation of sequence-specific DNA binding transcription factor activity	IMP	biological process
GO:0051091	positive regulation of sequence-specific DNA binding transcription factor activity	TAS	biological process
GO:0051444	negative regulation of ubiquitin-protein transferase activity	IDA	biological process
GO:0051583	dopamine uptake involved in synaptic transmission	IEA	biological process
GO:0051881	regulation of mitochondrial membrane potential	IMP	biological process
GO:0051897	positive regulation of protein kinase B signaling	IC	biological process
GO:0051899	membrane depolarization	IEA	biological process
GO:0051920	peroxiredoxin activity	IEA	molecular function
GO:0060081	membrane hyperpolarization	IEA	biological process
GO:0060548	negative regulation of cell death	IDA	biological process
GO:0060548	negative regulation of cell death	IDA	biological process
GO:0060765	regulation of androgen receptor signaling pathway	IDA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070301	cellular response to hydrogen peroxide	IDA	biological process
GO:0070491	repressing transcription factor binding	IPI	molecular function
GO:0070491	repressing transcription factor binding	IPI	molecular function
GO:0090073	positive regulation of protein homodimerization activity	IDA	biological process
GO:0097110	scaffold protein binding	IPI	molecular function
GO:0098793	presynapse	IEA	cellular component
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:1900182	positive regulation of protein localization to nucleus	IDA	biological process
GO:1900182	positive regulation of protein localization to nucleus	IMP	biological process
GO:1901215	negative regulation of neuron death	IDA	biological process
GO:1901671	positive regulation of superoxide dismutase activity	IDA	biological process
GO:1901984	negative regulation of protein acetylation	IDA	biological process
GO:1902177	positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway	IEA	biological process
GO:1902236	negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway	IGI	biological process
GO:1902903	regulation of supramolecular fiber organization	TAS	biological process
GO:1902958	positive regulation of mitochondrial electron transport, NADH to ubiquinone	IMP	biological process
GO:1903073	negative regulation of death-inducing signaling complex assembly	IC	biological process
GO:1903094	negative regulation of protein K48-linked deubiquitination	IDA	biological process
GO:1903122	negative regulation of TRAIL-activated apoptotic signaling pathway	IMP	biological process
GO:1903135	cupric ion binding	IDA	molecular function
GO:1903136	cuprous ion binding	IDA	molecular function
GO:1903136	cuprous ion binding	IDA	molecular function
GO:1903168	positive regulation of pyrroline-5-carboxylate reductase activity	IDA	biological process
GO:1903178	positive regulation of tyrosine 3-monooxygenase activity	IDA	biological process
GO:1903181	positive regulation of dopamine biosynthetic process	IC	biological process
GO:1903181	positive regulation of dopamine biosynthetic process	IDA	biological process
GO:1903190	glyoxal catabolic process	IDA	biological process
GO:1903197	positive regulation of L-dopa biosynthetic process	IMP	biological process
GO:1903200	positive regulation of L-dopa decarboxylase activity	IDA	biological process
GO:1903202	negative regulation of oxidative stress-induced cell death	IDA	biological process
GO:1903206	negative regulation of hydrogen peroxide-induced cell death	IMP	biological process
GO:1903206	negative regulation of hydrogen peroxide-induced cell death	IMP	biological process
GO:1903208	negative regulation of hydrogen peroxide-induced neuron death	IDA	biological process
GO:1903208	negative regulation of hydrogen peroxide-induced neuron death	IDA	biological process
GO:1903377	negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway	IDA	biological process
GO:1903384	negative regulation of hydrogen peroxide-induced neuron intrinsic apoptotic signaling pathway	IGI	biological process
GO:1903428	positive regulation of reactive oxygen species biosynthetic process	IEA	biological process
GO:1903599	positive regulation of mitophagy	NAS	biological process
GO:1990381	ubiquitin-specific protease binding	IPI	molecular function
GO:1990422	glyoxalase (glycolic acid-forming) activity	IDA	molecular function
GO:2000157	negative regulation of ubiquitin-specific protease activity	IDA	biological process
GO:2000277	positive regulation of oxidative phosphorylation uncoupler activity	IEA	biological process
GO:2000679	positive regulation of transcription regulatory region DNA binding	IMP	biological process
GO:2000825	positive regulation of androgen receptor activity	IMP	biological process
GO:2001237	negative regulation of extrinsic apoptotic signaling pathway	IMP	biological process
GO:2001268	negative regulation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway	IMP	biological process
GO:0001047	core promoter binding	IC	molecular function
GO:0003690	double-stranded DNA binding	IDA	molecular function
GO:0003697	single-stranded DNA binding	IDA	molecular function
GO:0045560	regulation of TRAIL receptor biosynthetic process	IMP	biological process
GO:0005747	mitochondrial respiratory chain complex I	IDA	cellular component
GO:0000785	chromatin	IDA	cellular component
GO:0001933	negative regulation of protein phosphorylation	IGI	biological process
GO:0001963	synaptic transmission, dopaminergic	IEA	biological process
GO:0003713	transcription coactivator activity	IGI	molecular function
GO:0003713	transcription coactivator activity	TAS	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0003729	mRNA binding	IDA	molecular function
GO:0005102	receptor binding	IPI	molecular function
GO:0005507	copper ion binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IMP	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005758	mitochondrial intermembrane space	IEA	cellular component
GO:0005759	mitochondrial matrix	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IMP	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006469	negative regulation of protein kinase activity	IGI	biological process
GO:0006508	proteolysis	IEA	biological process
GO:0006517	protein deglycosylation	IDA	biological process
GO:0006914	autophagy	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0006979	response to oxidative stress	IEA	biological process
GO:0007005	mitochondrion organization	IEA	biological process
GO:0007005	mitochondrion organization	ISS	biological process
GO:0007265	Ras protein signal transduction	TAS	biological process
GO:0007338	single fertilization	IEA	biological process
GO:0008134	transcription factor binding	IPI	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0008233	peptidase activity	IDA	molecular function
GO:0008344	adult locomotory behavior	IEA	biological process
GO:0010273	detoxification of copper ion	IEA	biological process
GO:0010273	detoxification of copper ion	IMP	biological process
GO:0010628	positive regulation of gene expression	IEA	biological process
GO:0010628	positive regulation of gene expression	TAS	biological process
GO:0010629	negative regulation of gene expression	IDA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016532	superoxide dismutase copper chaperone activity	IDA	molecular function
GO:0016605	PML body	IDA	cellular component
GO:0016684	oxidoreductase activity, acting on peroxide as acceptor	IDA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0018323	enzyme active site formation via L-cysteine sulfinic acid	IEA	biological process
GO:0019172	glyoxalase III activity	IEA	molecular function
GO:0019172	glyoxalase III activity	IDA	molecular function
GO:0019243	methylglyoxal catabolic process to D-lactate via S-lactoyl-glutathione	IEA	biological process
GO:0019243	methylglyoxal catabolic process to D-lactate via S-lactoyl-glutathione	IDA	biological process
GO:0019249	lactate biosynthetic process	IEA	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0019900	kinase binding	IPI	molecular function
GO:0019955	cytokine binding	IPI	molecular function
GO:0030424	axon	IEA	cellular component
GO:0030424	axon	ISS	cellular component
GO:0031397	negative regulation of protein ubiquitination	IEA	biological process
GO:0031397	negative regulation of protein ubiquitination	IDA	biological process
GO:0031397	negative regulation of protein ubiquitination	IDA	biological process
GO:0032091	negative regulation of protein binding	IDA	biological process
GO:0032091	negative regulation of protein binding	IGI	biological process
GO:0032091	negative regulation of protein binding	IDA	biological process
GO:0032091	negative regulation of protein binding	IDA	biological process
GO:0032091	negative regulation of protein binding	IMP	biological process
GO:0032091	negative regulation of protein binding	IDA	biological process
GO:0032148	activation of protein kinase B activity	IC	biological process
GO:0032435	negative regulation of proteasomal ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0032757	positive regulation of interleukin-8 production	IDA	biological process
GO:0033138	positive regulation of peptidyl-serine phosphorylation	IMP	biological process
GO:0033234	negative regulation of protein sumoylation	IDA	biological process
GO:0034599	cellular response to oxidative stress	IEA	biological process
GO:0034599	cellular response to oxidative stress	IDA	biological process
GO:0034599	cellular response to oxidative stress	IDA	biological process
GO:0034599	cellular response to oxidative stress	IDA	biological process
GO:0034599	cellular response to oxidative stress	IDA	biological process
GO:0034599	cellular response to oxidative stress	IMP	biological process
GO:0034614	cellular response to reactive oxygen species	IEA	biological process
GO:0036470	tyrosine 3-monooxygenase activator activity	IDA	molecular function
GO:0036471	cellular response to glyoxal	IEA	biological process
GO:0036471	cellular response to glyoxal	IDA	biological process
GO:0036478	L-dopa decarboxylase activator activity	IDA	molecular function
GO:0042177	negative regulation of protein catabolic process	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0042542	response to hydrogen peroxide	IEA	biological process
GO:0042743	hydrogen peroxide metabolic process	IEA	biological process
GO:0042743	hydrogen peroxide metabolic process	IDA	biological process
GO:0042743	hydrogen peroxide metabolic process	IDA	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0043005	neuron projection	IEA	cellular component
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0043066	negative regulation of apoptotic process	IDA	biological process
GO:0043523	regulation of neuron apoptotic process	IDA	biological process
GO:0043523	regulation of neuron apoptotic process	IDA	biological process
GO:0043524	negative regulation of neuron apoptotic process	IDA	biological process
GO:0044297	cell body	IEA	cellular component
GO:0044388	small protein activating enzyme binding	IPI	molecular function
GO:0044390	ubiquitin-like protein conjugating enzyme binding	IPI	molecular function
GO:0045121	membrane raft	IEA	cellular component
GO:0045340	mercury ion binding	IDA	molecular function
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IEA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IGI	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IMP	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IGI	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IMP	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IMP	biological process
GO:0046295	glycolate biosynthetic process	IEA	biological process
GO:0046295	glycolate biosynthetic process	IDA	biological process
GO:0046826	negative regulation of protein export from nucleus	IGI	biological process
GO:0050681	androgen receptor binding	IPI	molecular function
GO:0050727	regulation of inflammatory response	IEA	biological process
GO:0050727	regulation of inflammatory response	ISS	biological process
GO:0050787	detoxification of mercury ion	IEA	biological process
GO:0050787	detoxification of mercury ion	IMP	biological process
GO:0050821	protein stabilization	IEA	biological process
GO:0050821	protein stabilization	IMP	biological process
GO:0050821	protein stabilization	IMP	biological process
GO:0050821	protein stabilization	IMP	biological process
GO:0050821	protein stabilization	IDA	biological process
GO:0051091	positive regulation of sequence-specific DNA binding transcription factor activity	IMP	biological process
GO:0051091	positive regulation of sequence-specific DNA binding transcription factor activity	TAS	biological process
GO:0051444	negative regulation of ubiquitin-protein transferase activity	IDA	biological process
GO:0051583	dopamine uptake involved in synaptic transmission	IEA	biological process
GO:0051881	regulation of mitochondrial membrane potential	IMP	biological process
GO:0051897	positive regulation of protein kinase B signaling	IC	biological process
GO:0051899	membrane depolarization	IEA	biological process
GO:0051920	peroxiredoxin activity	IEA	molecular function
GO:0060081	membrane hyperpolarization	IEA	biological process
GO:0060548	negative regulation of cell death	IEA	biological process
GO:0060548	negative regulation of cell death	IDA	biological process
GO:0060548	negative regulation of cell death	IDA	biological process
GO:0060765	regulation of androgen receptor signaling pathway	IDA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070301	cellular response to hydrogen peroxide	IEA	biological process
GO:0070301	cellular response to hydrogen peroxide	IDA	biological process
GO:0070491	repressing transcription factor binding	IPI	molecular function
GO:0070491	repressing transcription factor binding	IPI	molecular function
GO:0090073	positive regulation of protein homodimerization activity	IDA	biological process
GO:0097110	scaffold protein binding	IPI	molecular function
GO:0098793	presynapse	IEA	cellular component
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:1900182	positive regulation of protein localization to nucleus	IDA	biological process
GO:1900182	positive regulation of protein localization to nucleus	IMP	biological process
GO:1901215	negative regulation of neuron death	IDA	biological process
GO:1901671	positive regulation of superoxide dismutase activity	IDA	biological process
GO:1901984	negative regulation of protein acetylation	IDA	biological process
GO:1902177	positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway	IEA	biological process
GO:1902236	negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway	IEA	biological process
GO:1902236	negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway	IGI	biological process
GO:1902903	regulation of supramolecular fiber organization	TAS	biological process
GO:1902958	positive regulation of mitochondrial electron transport, NADH to ubiquinone	IEA	biological process
GO:1902958	positive regulation of mitochondrial electron transport, NADH to ubiquinone	IMP	biological process
GO:1903073	negative regulation of death-inducing signaling complex assembly	IC	biological process
GO:1903094	negative regulation of protein K48-linked deubiquitination	IDA	biological process
GO:1903122	negative regulation of TRAIL-activated apoptotic signaling pathway	IMP	biological process
GO:1903135	cupric ion binding	IDA	molecular function
GO:1903136	cuprous ion binding	IDA	molecular function
GO:1903136	cuprous ion binding	IDA	molecular function
GO:1903168	positive regulation of pyrroline-5-carboxylate reductase activity	IDA	biological process
GO:1903178	positive regulation of tyrosine 3-monooxygenase activity	IDA	biological process
GO:1903181	positive regulation of dopamine biosynthetic process	IC	biological process
GO:1903181	positive regulation of dopamine biosynthetic process	IDA	biological process
GO:1903190	glyoxal catabolic process	IEA	biological process
GO:1903190	glyoxal catabolic process	IDA	biological process
GO:1903197	positive regulation of L-dopa biosynthetic process	IMP	biological process
GO:1903200	positive regulation of L-dopa decarboxylase activity	IDA	biological process
GO:1903202	negative regulation of oxidative stress-induced cell death	IDA	biological process
GO:1903204	negative regulation of oxidative stress-induced neuron death	IEA	biological process
GO:1903206	negative regulation of hydrogen peroxide-induced cell death	IMP	biological process
GO:1903206	negative regulation of hydrogen peroxide-induced cell death	IMP	biological process
GO:1903208	negative regulation of hydrogen peroxide-induced neuron death	IEA	biological process
GO:1903208	negative regulation of hydrogen peroxide-induced neuron death	IDA	biological process
GO:1903208	negative regulation of hydrogen peroxide-induced neuron death	IDA	biological process
GO:1903377	negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway	IDA	biological process
GO:1903384	negative regulation of hydrogen peroxide-induced neuron intrinsic apoptotic signaling pathway	IEA	biological process
GO:1903384	negative regulation of hydrogen peroxide-induced neuron intrinsic apoptotic signaling pathway	IGI	biological process
GO:1903428	positive regulation of reactive oxygen species biosynthetic process	IEA	biological process
GO:1903599	positive regulation of mitophagy	NAS	biological process
GO:1990381	ubiquitin-specific protease binding	IPI	molecular function
GO:1990422	glyoxalase (glycolic acid-forming) activity	IEA	molecular function
GO:1990422	glyoxalase (glycolic acid-forming) activity	IDA	molecular function
GO:2000157	negative regulation of ubiquitin-specific protease activity	IDA	biological process
GO:2000277	positive regulation of oxidative phosphorylation uncoupler activity	IEA	biological process
GO:2000679	positive regulation of transcription regulatory region DNA binding	IMP	biological process
GO:2000825	positive regulation of androgen receptor activity	IMP	biological process
GO:2001237	negative regulation of extrinsic apoptotic signaling pathway	IMP	biological process
GO:2001268	negative regulation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway	IMP	biological process
GO:0001047	core promoter binding	IC	molecular function
GO:0003690	double-stranded DNA binding	IDA	molecular function
GO:0003697	single-stranded DNA binding	IDA	molecular function
GO:0045560	regulation of TRAIL receptor biosynthetic process	IMP	biological process
GO:0005747	mitochondrial respiratory chain complex I	IDA	cellular component
GO:0000785	chromatin	IDA	cellular component
GO:0001933	negative regulation of protein phosphorylation	IGI	biological process
GO:0003713	transcription coactivator activity	IGI	molecular function
GO:0003713	transcription coactivator activity	TAS	molecular function
GO:0003729	mRNA binding	IDA	molecular function
GO:0005102	receptor binding	IPI	molecular function
GO:0005507	copper ion binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IMP	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IMP	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0006469	negative regulation of protein kinase activity	IGI	biological process
GO:0006517	protein deglycosylation	IDA	biological process
GO:0007005	mitochondrion organization	ISS	biological process
GO:0007265	Ras protein signal transduction	TAS	biological process
GO:0008134	transcription factor binding	IPI	molecular function
GO:0008233	peptidase activity	IDA	molecular function
GO:0010273	detoxification of copper ion	IMP	biological process
GO:0010628	positive regulation of gene expression	TAS	biological process
GO:0010629	negative regulation of gene expression	IDA	biological process
GO:0016532	superoxide dismutase copper chaperone activity	IDA	molecular function
GO:0016605	PML body	IDA	cellular component
GO:0016684	oxidoreductase activity, acting on peroxide as acceptor	IDA	molecular function
GO:0019172	glyoxalase III activity	IDA	molecular function
GO:0019243	methylglyoxal catabolic process to D-lactate via S-lactoyl-glutathione	IDA	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0019900	kinase binding	IPI	molecular function
GO:0019955	cytokine binding	IPI	molecular function
GO:0030424	axon	ISS	cellular component
GO:0031397	negative regulation of protein ubiquitination	IDA	biological process
GO:0031397	negative regulation of protein ubiquitination	IDA	biological process
GO:0032091	negative regulation of protein binding	IDA	biological process
GO:0032091	negative regulation of protein binding	IGI	biological process
GO:0032091	negative regulation of protein binding	IDA	biological process
GO:0032091	negative regulation of protein binding	IDA	biological process
GO:0032091	negative regulation of protein binding	IMP	biological process
GO:0032091	negative regulation of protein binding	IDA	biological process
GO:0032148	activation of protein kinase B activity	IC	biological process
GO:0032435	negative regulation of proteasomal ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0032757	positive regulation of interleukin-8 production	IDA	biological process
GO:0033138	positive regulation of peptidyl-serine phosphorylation	IMP	biological process
GO:0033234	negative regulation of protein sumoylation	IDA	biological process
GO:0034599	cellular response to oxidative stress	IDA	biological process
GO:0034599	cellular response to oxidative stress	IDA	biological process
GO:0034599	cellular response to oxidative stress	IDA	biological process
GO:0034599	cellular response to oxidative stress	IDA	biological process
GO:0034599	cellular response to oxidative stress	IMP	biological process
GO:0036470	tyrosine 3-monooxygenase activator activity	IDA	molecular function
GO:0036471	cellular response to glyoxal	IDA	biological process
GO:0036478	L-dopa decarboxylase activator activity	IDA	molecular function
GO:0042743	hydrogen peroxide metabolic process	IDA	biological process
GO:0042743	hydrogen peroxide metabolic process	IDA	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0043066	negative regulation of apoptotic process	IDA	biological process
GO:0043523	regulation of neuron apoptotic process	IDA	biological process
GO:0043523	regulation of neuron apoptotic process	IDA	biological process
GO:0043524	negative regulation of neuron apoptotic process	IDA	biological process
GO:0044388	small protein activating enzyme binding	IPI	molecular function
GO:0044390	ubiquitin-like protein conjugating enzyme binding	IPI	molecular function
GO:0045340	mercury ion binding	IDA	molecular function
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IGI	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IMP	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IGI	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IMP	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IMP	biological process
GO:0046295	glycolate biosynthetic process	IDA	biological process
GO:0046826	negative regulation of protein export from nucleus	IGI	biological process
GO:0050681	androgen receptor binding	IPI	molecular function
GO:0050727	regulation of inflammatory response	ISS	biological process
GO:0050787	detoxification of mercury ion	IMP	biological process
GO:0050821	protein stabilization	IMP	biological process
GO:0050821	protein stabilization	IMP	biological process
GO:0050821	protein stabilization	IMP	biological process
GO:0050821	protein stabilization	IDA	biological process
GO:0051091	positive regulation of sequence-specific DNA binding transcription factor activity	IMP	biological process
GO:0051091	positive regulation of sequence-specific DNA binding transcription factor activity	TAS	biological process
GO:0051444	negative regulation of ubiquitin-protein transferase activity	IDA	biological process
GO:0051881	regulation of mitochondrial membrane potential	IMP	biological process
GO:0051897	positive regulation of protein kinase B signaling	IC	biological process
GO:0060548	negative regulation of cell death	IDA	biological process
GO:0060548	negative regulation of cell death	IDA	biological process
GO:0060765	regulation of androgen receptor signaling pathway	IDA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070301	cellular response to hydrogen peroxide	IDA	biological process
GO:0070491	repressing transcription factor binding	IPI	molecular function
GO:0070491	repressing transcription factor binding	IPI	molecular function
GO:0090073	positive regulation of protein homodimerization activity	IDA	biological process
GO:0097110	scaffold protein binding	IPI	molecular function
GO:1900182	positive regulation of protein localization to nucleus	IDA	biological process
GO:1900182	positive regulation of protein localization to nucleus	IMP	biological process
GO:1901215	negative regulation of neuron death	IDA	biological process
GO:1901671	positive regulation of superoxide dismutase activity	IDA	biological process
GO:1901984	negative regulation of protein acetylation	IDA	biological process
GO:1902236	negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway	IGI	biological process
GO:1902903	regulation of supramolecular fiber organization	TAS	biological process
GO:1902958	positive regulation of mitochondrial electron transport, NADH to ubiquinone	IMP	biological process
GO:1903073	negative regulation of death-inducing signaling complex assembly	IC	biological process
GO:1903094	negative regulation of protein K48-linked deubiquitination	IDA	biological process
GO:1903122	negative regulation of TRAIL-activated apoptotic signaling pathway	IMP	biological process
GO:1903135	cupric ion binding	IDA	molecular function
GO:1903136	cuprous ion binding	IDA	molecular function
GO:1903136	cuprous ion binding	IDA	molecular function
GO:1903168	positive regulation of pyrroline-5-carboxylate reductase activity	IDA	biological process
GO:1903178	positive regulation of tyrosine 3-monooxygenase activity	IDA	biological process
GO:1903181	positive regulation of dopamine biosynthetic process	IC	biological process
GO:1903181	positive regulation of dopamine biosynthetic process	IDA	biological process
GO:1903190	glyoxal catabolic process	IDA	biological process
GO:1903197	positive regulation of L-dopa biosynthetic process	IMP	biological process
GO:1903200	positive regulation of L-dopa decarboxylase activity	IDA	biological process
GO:1903202	negative regulation of oxidative stress-induced cell death	IDA	biological process
GO:1903206	negative regulation of hydrogen peroxide-induced cell death	IMP	biological process
GO:1903206	negative regulation of hydrogen peroxide-induced cell death	IMP	biological process
GO:1903208	negative regulation of hydrogen peroxide-induced neuron death	IDA	biological process
GO:1903208	negative regulation of hydrogen peroxide-induced neuron death	IDA	biological process
GO:1903377	negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway	IDA	biological process
GO:1903384	negative regulation of hydrogen peroxide-induced neuron intrinsic apoptotic signaling pathway	IGI	biological process
GO:1903599	positive regulation of mitophagy	NAS	biological process
GO:1990381	ubiquitin-specific protease binding	IPI	molecular function
GO:1990422	glyoxalase (glycolic acid-forming) activity	IDA	molecular function
GO:2000157	negative regulation of ubiquitin-specific protease activity	IDA	biological process
GO:2000679	positive regulation of transcription regulatory region DNA binding	IMP	biological process
GO:2000825	positive regulation of androgen receptor activity	IMP	biological process
GO:2001237	negative regulation of extrinsic apoptotic signaling pathway	IMP	biological process
GO:2001268	negative regulation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway	IMP	biological process
GO:0001047	core promoter binding	IC	molecular function
GO:0003690	double-stranded DNA binding	IDA	molecular function
GO:0003697	single-stranded DNA binding	IDA	molecular function
GO:0045560	regulation of TRAIL receptor biosynthetic process	IMP	biological process
GO:0005747	mitochondrial respiratory chain complex I	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05012	Parkinson disease

Diseases

Associated diseases	References
Celiac disease	GAD: 20190752
Ulcerative colitis	GAD: 21297633
Ulcerative colitis	GAD: 21297633
Parkinson disease	OMIM: 15970950
Dementia	GAD: 15542239
Psychological disorders	GAD: 15542239
Endometriosis	INFBASE: 21445310
Asthenozoospermia	MIK: 21575935
Male factor infertility	MIK: 12876366
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Asthenozoospermia	MIK: 21575935
Male infertility	MIK: 29849492
Parkinson	MIK: 12876366
Oligozoospermia	MIK: 21989496
Role in spermatogenesis and fertilization in humans	MIK: 14579415
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21575935	Asthenozoospermia		Chinese	284(113 asthenozoospermia patients, 70 mild asthenozoospermia, 43 moderate asthenozoospermia, 58 age-matched control)	Male infertility
21575935	Asthenozoospermia, Male infertility		Chinese	184 (113 asthenozoospermia patients, 70 mild asthenozoospermia patients, 43 moderate asthenozoospermia patients, 58 age-matched controls)	Male infertility
23455884	Idiopathic asthenozoospermia				Male infertility	GRP78 lactoferrin SPANXB PGK2 flagellin DJ-1 XPA binding protein 2 CAB2 GPX4 and GAPDH
24920663	Asthenozoospermia		Chinese		Male infertility
12876366	Male infertility, parkinson				Male infertility	DJ-1
28932933	Male infertility	g.-6_+10del and g.168_185del polymorphisms		707 (422 male infertile patients, 285 fertile controls )	Male infertility
14579415	Role in spermatogenesis and fertilization in humans				Male infertility
29849492	Asthenozoospermia, Male infertility				Male infertility
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
21989496	Oligozoospermia			11 (8 infertile and 3 fertile men)	Male infertility	Microarray