• Gene id: 113130

Gene Summary

• Gene Symbol: CDCA5   Gene   UCSC   Ensembl
• Aliases: SORORIN
• Gene name: cell division cycle associated 5
• Alternate names: sororin, cell division cycle-associated protein 5, p35,
• Gene location: 11q13.1 (65084128: 65061008)     Exons: 16     NC_000011.10
• OMIM: 131310

Protein Summary

• Protein general information: Q96FF9  
  • Name: Sororin (Cell division cycle associated protein 5) (p35)
  • Length: 252  
  • Mass: 27601
• Sequence:

  MSGRRTRSGGAAQRSGPRAPSPTKPLRRSQRKSGSELPSILPEIWPKTPSAAAVRKPIVLKRIVAHAVEVPAVQS
  PRRSPRISFFLEKENEPPGRELTKEDLFKTHSVPATPTSTPVPNPEAESSSKEGELDARDLEMSKKVRRSYSRLE
  TLGSASTSTPGRRSCFGFEGLLGAEDLSGVSPVVCSKLTEVPRVCAKPWAPDMTLPGISPPPEKQKRKKKKMPEI
  LKTELDEWAAAMNAEFEAAEQFDLLVE

• Structural information:
  • Interpro: IPR018605  
  • DIP: 47377
  • STRING: ENSP00000275517
• Other Databases: GeneCards:  CDCA5  Malacards:  CDCA5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007064	mitotic sister chromatid cohesion	IBA	biological process
GO:0007080	mitotic metaphase plate congression	IBA	biological process
GO:0071922	regulation of cohesin loading	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0006302	double-strand break repair	IBA	biological process
GO:0031536	positive regulation of exit from mitosis	IBA	biological process
GO:0071922	regulation of cohesin loading	IMP	biological process
GO:0007064	mitotic sister chromatid cohesion	IMP	biological process
GO:0007064	mitotic sister chromatid cohesion	IMP	biological process
GO:0006302	double-strand break repair	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000790	nuclear chromatin	ISS	cellular component
GO:0051301	cell division	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0000775	chromosome, centromeric region	TAS	cellular component
GO:0000775	chromosome, centromeric region	TAS	cellular component
GO:0000775	chromosome, centromeric region	TAS	cellular component
GO:0000775	chromosome, centromeric region	TAS	cellular component
GO:0000775	chromosome, centromeric region	TAS	cellular component
GO:0000775	chromosome, centromeric region	TAS	cellular component
GO:0000775	chromosome, centromeric region	TAS	cellular component
GO:0005694	chromosome	TAS	cellular component
GO:0005694	chromosome	TAS	cellular component
GO:0005694	chromosome	TAS	cellular component
GO:0005694	chromosome	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007064	mitotic sister chromatid cohesion	IEA	biological process
GO:0000278	mitotic cell cycle	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0000790	nuclear chromatin	IEA	cellular component
GO:0000785	chromatin	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0044877	protein-containing complex binding	IDA	molecular function
GO:0000278	mitotic cell cycle	IDA	biological process
GO:0031536	positive regulation of exit from mitosis	IMP	biological process
GO:0007080	mitotic metaphase plate congression	IMP	biological process
GO:0007076	mitotic chromosome condensation	IMP	biological process
GO:0005737	cytoplasm	ISS	cellular component
GO:0005634	nucleus	ISS	cellular component
GO:0007064	mitotic sister chromatid cohesion	IPI	biological process
GO:0003682	chromatin binding	TAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05206	MicroRNAs in cancer

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray