• Gene id: 1131

Gene Summary

• Gene Symbol: CHRM3   Gene   UCSC   Ensembl
• Aliases: EGBRS, HM3, PBS
• Gene name: cholinergic receptor muscarinic 3
• Alternate names: muscarinic acetylcholine receptor M3, acetylcholine receptor, muscarinic 3, m3 muscarinic receptor,
• Gene location: 1q43 (239386564: 239915449)     Exons: 17     NC_000001.11
• Gene summary(Entrez): The muscarinic cholinergic receptors belong to a larger family of G protein-coupled receptors. The functional diversity of these receptors is defined by the binding of acetylcholine and includes cellular responses such as adenylate cyclase inhibition, pho
• OMIM: 118494

Protein Summary

• Protein general information: P20309  
  • Name: Muscarinic acetylcholine receptor M3
  • Length: 590  
  • Mass: 66128
• Sequence:

  MTLHNNSTTSPLFPNISSSWIHSPSDAGLPPGTVTHFGSYNVSRAAGNFSSPDGTTDDPLGGHTVWQVVFIAFLT
  GILALVTIIGNILVIVSFKVNKQLKTVNNYFLLSLACADLIIGVISMNLFTTYIIMNRWALGNLACDLWLAIDYV
  ASNASVMNLLVISFDRYFSITRPLTYRAKRTTKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQF
  LSEPTITFGTAIAAFYMPVTIMTILYWRIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSM
  KRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSETRAIYSIVLKLPGHS
  TILNSTKLPSSDNLQVPEEELGMVDLERKADKLQAQKSVDDGGSFPKSFSKLPIQLESAVDTAKTSDVNSSVGKS
  TATLPLSFKEATLAKRFALKTRSQITKRKRMSLVKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTF
  WNLGYWLCYINSTVNPVCYALCNKTFRTTFKMLLLCQCDKKKRRKQQYQQRQSVIFHKRAPEQAL

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR001183  IPR000995  
  • Prosite: PS00237 PS50262
  • PDB: 2CSA
  • PDBsum: 2CSA
  • DIP: 44291
  • STRING: ENSP00000255380
• Other Databases: GeneCards:  CHRM3  Malacards:  CHRM3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0009925	basal plasma membrane	IDA	cellular component
GO:0019722	calcium-mediated signaling	IDA	biological process
GO:0095500	acetylcholine receptor signaling pathway	IDA	biological process
GO:0032412	regulation of ion transmembrane transporter activity	IDA	biological process
GO:0032412	regulation of ion transmembrane transporter activity	IDA	biological process
GO:0030425	dendrite	IBA	cellular component
GO:0016907	G protein-coupled acetylcholine receptor activity	IBA	molecular function
GO:0007268	chemical synaptic transmission	IBA	biological process
GO:0007187	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	IBA	biological process
GO:0004993	G protein-coupled serotonin receptor activity	IBA	molecular function
GO:0003056	regulation of vascular smooth muscle contraction	IBA	biological process
GO:0045202	synapse	IBA	cellular component
GO:0030594	neurotransmitter receptor activity	IBA	molecular function
GO:0007197	adenylate cyclase-inhibiting G protein-coupled acetylcholine receptor signaling pathway	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0042166	acetylcholine binding	ISS	molecular function
GO:0016907	G protein-coupled acetylcholine receptor activity	ISS	molecular function
GO:0005887	integral component of plasma membrane	ISS	cellular component
GO:0007213	G protein-coupled acetylcholine receptor signaling pathway	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0016907	G protein-coupled acetylcholine receptor activity	IEA	molecular function
GO:0045987	positive regulation of smooth muscle contraction	IEA	biological process
GO:0046541	saliva secretion	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0004435	phosphatidylinositol phospholipase C activity	TAS	molecular function
GO:0038023	signaling receptor activity	TAS	molecular function
GO:0016907	G protein-coupled acetylcholine receptor activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0007399	nervous system development	TAS	biological process
GO:0006464	cellular protein modification process	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006939	smooth muscle contraction	IEA	biological process
GO:0045987	positive regulation of smooth muscle contraction	IEA	biological process
GO:0046541	saliva secretion	IEA	biological process
GO:0003056	regulation of vascular smooth muscle contraction	IEA	biological process
GO:0016907	G protein-coupled acetylcholine receptor activity	IEA	molecular function
GO:0030425	dendrite	IEA	cellular component
GO:0032279	asymmetric synapse	IEA	cellular component
GO:0042166	acetylcholine binding	IEA	molecular function
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:1904695	positive regulation of vascular smooth muscle contraction	IEA	biological process
GO:0007271	synaptic transmission, cholinergic	IEA	biological process
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0007213	G protein-coupled acetylcholine receptor signaling pathway	IEA	biological process
GO:0008144	drug binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0019229	regulation of vasoconstriction	IEA	biological process
GO:0043679	axon terminus	IEA	cellular component
GO:0099056	integral component of presynaptic membrane	IEA	cellular component
GO:0099061	integral component of postsynaptic density membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0098664	G protein-coupled serotonin receptor signaling pathway	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa05010	Alzheimer disease
hsa04080	Neuroactive ligand-receptor interaction
hsa04810	Regulation of actin cytoskeleton
hsa04020	Calcium signaling pathway
hsa04725	Cholinergic synapse
hsa04972	Pancreatic secretion
hsa04970	Salivary secretion
hsa04911	Insulin secretion
hsa04971	Gastric acid secretion
hsa04742	Taste transduction

Diseases

Associated diseases	References
Prune belly syndrome	KEGG:H02129
Prune belly syndrome	KEGG:H02129
Cancer (small cell)	PMID:20150622
Asthma	PMID:20394512
Chronic obstructive pulmonary disease	PMID:19281093
Bladder disease	PMID:17922784
Pulmonary fibrosis	PMID:18480105
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray