• Gene id: 11309

Gene Summary

• Gene Symbol: SLCO2B1   Gene   UCSC   Ensembl
• Aliases: OATP-B, OATP2B1, OATPB, SLC21A9
• Gene name: solute carrier organic anion transporter family member 2B1
• Alternate names: solute carrier organic anion transporter family member 2B1, OATP-RP2, organic anion transporter B, organic anion transporter polypeptide-related protein 2, solute carrier family 21 (organic anion transporter), member 9,
• Gene location: 11q13.4 (75151106: 75206548)     Exons: 16     NC_000011.10
• Gene summary(Entrez): This locus encodes a member of the organic anion-transporting polypeptide family of membrane proteins. The protein encoded by this locus may function in regulation of placental uptake of sulfated steroids. Alternatively spliced transcript variants have be
• OMIM: 606336

Protein Summary

• Protein general information: O94956  
  • Name: Solute carrier organic anion transporter family member 2B1 (Organic anion transporter B) (OATP B) (Organic anion transporter polypeptide related protein 2) (OATP RP2) (OATPRP2) (Solute carrier family 21 member 9)
  • Length: 709  
  • Mass: 76711
  • Tissue specificity: Isoform 1 has it's highest expression in brain, it is the major form expressed in duodenum, kidney, placenta, and skeletal muscle. Isoform 3 predominates in liver. {ECO
• Sequence:

  MGPRIGPAGEVPQVPDKETKATMGTENTPGGKASPDPQDVRPSVFHNIKLFVLCHSLLQLAQLMISGYLKSSIST
  VEKRFGLSSQTSGLLASFNEVGNTALIVFVSYFGSRVHRPRMIGYGAILVALAGLLMTLPHFISEPYRYDNTSPE
  DMPQDFKASLCLPTTSAPASAPSNGNCSSYTETQHLSVVGIMFVAQTLLGVGGVPIQPFGISYIDDFAHNSNSPL
  YLGILFAVTMMGPGLAFGLGSLMLRLYVDINQMPEGGISLTIKDPRWVGAWWLGFLIAAGAVALAAIPYFFFPKE
  MPKEKRELQFRRKVLAVTDSPARKGKDSPSKQSPGESTKKQDGLVQIAPNLTVIQFIKVFPRVLLQTLRHPIFLL
  VVLSQVCLSSMAAGMAIFLPKFLERQFSITASYANLLIGCLSFPSVIVGIVVGGVLVKRLHLGPVGCGALCLLGM
  LLCLFFSLPLFFIGCSSHQIAGITHQTSAHPGLELSPSCMEACSCPLDGFNPVCDPSTRVEYITPCHAGCSSWVV
  QDALDNSQVFYTNCSCVVEGNPVLAGSCDSTCSHLVVPFLLLVSLGSALACLTHTPSFMLILRGVKKEDKTLAVG
  IQFMFLRILAWMPSPVIHGSAIDTTCVHWALSCGRRAVCRYYNNDLLRNRFIGLQFFFKTGSVICFALVLAVLRQ
  QDKEARTKESRSSPAVEQQLLVSGPGKKPEDSRV

• Structural information:
  • Protein Domains: (483..54-)
    (/note="Kazal-like-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00798"-)
  • Interpro: IPR002350  IPR036259  IPR004156  
  • Prosite: PS51465
  • STRING: ENSP00000289575
• Other Databases: GeneCards:  SLCO2B1  Malacards:  SLCO2B1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IDA	cellular component
GO:0016324	apical plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0008514	organic anion transmembrane transporter activity	IDA	molecular function
GO:0008514	organic anion transmembrane transporter activity	IDA	molecular function
GO:0015711	organic anion transport	IDA	biological process
GO:0015711	organic anion transport	IDA	biological process
GO:0055085	transmembrane transport	IDA	biological process
GO:0055085	transmembrane transport	IDA	biological process
GO:0150104	transport across blood-brain barrier	NAS	biological process
GO:0150104	transport across blood-brain barrier	NAS	biological process
GO:0016324	apical plasma membrane	ISS	cellular component
GO:0055085	transmembrane transport	IMP	biological process
GO:0015721	bile acid and bile salt transport	IBA	biological process
GO:0015347	sodium-independent organic anion transmembrane transporter activity	IBA	molecular function
GO:0015125	bile acid transmembrane transporter activity	IBA	molecular function
GO:0043252	sodium-independent organic anion transport	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0043252	sodium-independent organic anion transport	TAS	biological process
GO:0015347	sodium-independent organic anion transmembrane transporter activity	TAS	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0015347	sodium-independent organic anion transmembrane transporter activity	IDA	molecular function
GO:0008514	organic anion transmembrane transporter activity	IDA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Male factor infertility	MIK: 29961538

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
29961538	Male factor infertility			318 (128 couples presenting with OAT (MF) and 118 maternal age-matched control (no MF) subjects undergoing infertility treatment, 72 surplus cryopreserved blastocysts)	Male infertility	RNA-seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq