• Gene id: 112936

Gene Summary

• Gene Symbol: VPS26B   Gene   UCSC   Ensembl
• Aliases: Pep8b
• Gene name: VPS26, retromer complex component B
• Alternate names: vacuolar protein sorting-associated protein 26B, vesicle protein sorting 26B,
• Gene location: 11q25 (134224663: 134247787)     Exons: 7     NC_000011.10
• OMIM: 610027

Protein Summary

• Protein general information: Q4G0F5  
  • Name: Vacuolar protein sorting associated protein 26B (Vesicle protein sorting 26B)
  • Length: 336  
  • Mass: 39155
• Sequence:

  MSFFGFGQSVEVEILLNDAESRKRAEHKTEDGKKEKYFLFYDGETVSGKVSLALKNPNKRLEHQGIKIEFIGQIE
  LYYDRGNHHEFVSLVKDLARPGEITQSQAFDFEFTHVEKPYESYTGQNVKLRYFLRATISRRLNDVVKEMDIVVH
  TLSTYPELNSSIKMEVGIEDCLHIEFEYNKSKYHLKDVIVGKIYFLLVRIKIKHMEIDIIKRETTGTGPNVYHEN
  DTIAKYEIMDGAPVRGESIPIRLFLAGYELTPTMRDINKKFSVRYYLNLVLIDEEERRYFKQQEVVLWRKGDIVR
  KSMSHQAAIASQRFEGTTSLGEVRTPSQLSDNNCRQ

• Structural information:
  • Interpro: IPR014752  IPR028934  
  • STRING: ENSP00000281187
• Other Databases: GeneCards:  VPS26B  Malacards:  VPS26B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016241	regulation of macroautophagy	TAS	biological process
GO:0030904	retromer complex	ISS	cellular component
GO:0030906	retromer, cargo-selective complex	NAS	cellular component
GO:0042147	retrograde transport, endosome to Golgi	NAS	biological process
GO:0006886	intracellular protein transport	IBA	biological process
GO:0030904	retromer complex	IBA	cellular component
GO:0042147	retrograde transport, endosome to Golgi	IBA	biological process
GO:0005768	endosome	IBA	cellular component
GO:0005770	late endosome	ISS	cellular component
GO:0005769	early endosome	ISS	cellular component
GO:0030904	retromer complex	ISS	cellular component
GO:0042147	retrograde transport, endosome to Golgi	ISS	biological process
GO:0006886	intracellular protein transport	IEA	biological process
GO:0005768	endosome	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0071346	cellular response to interferon-gamma	IEA	biological process
GO:0045335	phagocytic vesicle	IEA	cellular component
GO:0042147	retrograde transport, endosome to Golgi	IEA	biological process
GO:0030904	retromer complex	IEA	cellular component
GO:0005770	late endosome	IEA	cellular component
GO:0005769	early endosome	IEA	cellular component
GO:0005769	early endosome	IEA	cellular component
GO:0005770	late endosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04144	Endocytosis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq