• Gene id: 1129

Gene Summary

• Gene Symbol: CHRM2   Gene   UCSC   Ensembl
• Aliases: HM2
• Gene name: cholinergic receptor muscarinic 2
• Alternate names: muscarinic acetylcholine receptor M2, 7TM receptor, acetylcholine receptor, muscarinic 2, cholinergic receptor, muscarinic 2, muscarinic M2 receptor,
• Gene location: 7q33 (136868636: 137020254)     Exons: 7     NC_000007.14
• Gene summary(Entrez): The muscarinic cholinergic receptors belong to a larger family of G protein-coupled receptors. The functional diversity of these receptors is defined by the binding of acetylcholine to these receptors and includes cellular responses such as adenylate cycl

Protein Summary

• Protein general information: P08172  
  • Name: Muscarinic acetylcholine receptor M2
  • Length: 466  
  • Mass: 51715
• Sequence:

  MNNSTNSSNNSLALTSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNYFLFSLACADLIIGVF
  SMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFDRYFCVTKPLTYPVKRTTKMAGMMIAAAWVL
  SFILWAPAILFWQFIVGVRTVEDGECYIQFFSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRIKKDKKEPV
  ANQDPVSPSLVQGRIVKPNNNNMPSSDDGLEHNKIQNGKAPRDPVTENCVQGEEKESSNDSTSVSAVASNMRDDE
  ITQDENTVSTSLGHSKDENSKQTCIRIGTKTPKSDSCTPTNTTVEVVGSSGQNGDEKQNIVARKIVKMTKQPAKK
  KPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNTVWTIGYWLCYINSTINPACYALCNATFKKT
  FKHLLMCHYKNIGATR

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR001065  IPR000995  
  • Prosite: PS00237 PS50262
  • PDB: 1LUB 3UON 4MQS 4MQT 5YC8 5ZK3 5ZK8 5ZKB 5ZKC 6OIK
  • PDBsum: 1LUB 3UON 4MQS 4MQT 5YC8 5ZK3 5ZK8 5ZKB 5ZKC 6OIK
  • DIP: 56282
  • STRING: ENSP00000399745
• Other Databases: GeneCards:  CHRM2  Malacards:  CHRM2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030425	dendrite	IBA	cellular component
GO:0016907	G protein-coupled acetylcholine receptor activity	IBA	molecular function
GO:0007268	chemical synaptic transmission	IBA	biological process
GO:0007187	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	IBA	biological process
GO:0006940	regulation of smooth muscle contraction	IBA	biological process
GO:0004993	G protein-coupled serotonin receptor activity	IBA	molecular function
GO:0045202	synapse	IBA	cellular component
GO:0030594	neurotransmitter receptor activity	IBA	molecular function
GO:0007197	adenylate cyclase-inhibiting G protein-coupled acetylcholine receptor signaling pathway	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0016907	G protein-coupled acetylcholine receptor activity	IDA	molecular function
GO:0007213	G protein-coupled acetylcholine receptor signaling pathway	IDA	biological process
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0008016	regulation of heart contraction	IEA	biological process
GO:0016907	G protein-coupled acetylcholine receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016907	G protein-coupled acetylcholine receptor activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0007399	nervous system development	TAS	biological process
GO:0007187	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	TAS	biological process
GO:0007188	adenylate cyclase-modulating G protein-coupled receptor signaling pathway	TAS	biological process
GO:0007207	phospholipase C-activating G protein-coupled acetylcholine receptor signaling pathway	TAS	biological process
GO:0008016	regulation of heart contraction	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0061024	membrane organization	TAS	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0007213	G protein-coupled acetylcholine receptor signaling pathway	IEA	biological process
GO:0099056	integral component of presynaptic membrane	IEA	cellular component
GO:0043679	axon terminus	IEA	cellular component
GO:0043025	neuronal cell body	IEA	cellular component
GO:0032280	symmetric synapse	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007213	G protein-coupled acetylcholine receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:2000300	regulation of synaptic vesicle exocytosis	IEA	biological process
GO:0098981	cholinergic synapse	IEA	cellular component
GO:0016907	G protein-coupled acetylcholine receptor activity	IEA	molecular function
GO:0099055	integral component of postsynaptic membrane	IEA	cellular component
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0032279	asymmetric synapse	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0016907	G protein-coupled acetylcholine receptor activity	IEA	molecular function
GO:0006940	regulation of smooth muscle contraction	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0098664	G protein-coupled serotonin receptor signaling pathway	IEA	biological process
GO:1990763	arrestin family protein binding	IPI	molecular function
GO:0016021	integral component of membrane	IDA	cellular component
GO:0009615	response to virus	IEP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04151	PI3K-Akt signaling pathway
hsa04810	Regulation of actin cytoskeleton
hsa04024	cAMP signaling pathway
hsa04020	Calcium signaling pathway
hsa04725	Cholinergic synapse

Diseases

Associated diseases	References
Major depressive disorder	PMID:19103464
Major depressive disorder	PMID:12116189
Asthma	PMID:19308904
Bipolar disorder	PMID:19103464
Bipolar disorder	PMID:20351719
Schizophrenia	PMID:20691427
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq