• Gene id: 112869

Gene Summary

• Gene Symbol: SGF29   Gene   UCSC   Ensembl
• Aliases: CCDC101, STAF36, TDRD29
• Gene name: SAGA complex associated factor 29
• Alternate names: SAGA-associated factor 29, SAGA-associated factor 29 homolog, coiled-coil domain containing 101, coiled-coil domain-containing protein 101,
• Gene location: 16p11.2 (28553914: 28591789)     Exons: 11     NC_000016.10
• Gene summary(Entrez): CCDC101 is a subunit of 2 histone acetyltransferase complexes: the ADA2A (TADA2A; MIM 602276)-containing (ATAC) complex and the SPT3 (SUPT3H; MIM 602947)-TAF9 (MIM 600822)-GCN5 (KAT2A; MIM 602301)/PCAF (KAT2B; MIM 602303) acetylase (STAGA) complex. Both o
• OMIM: 613374

Protein Summary

• Protein general information: Q96ES7  
  • Name: SAGA associated factor 29 (Coiled coil domain containing protein 101) (SAGA complex associated factor 29)
  • Length: 293  
  • Mass: 33238
• Sequence:

  MALVSADSRIAELLTELHQLIKQTQEERSRSEHNLVNIQKTHERMQTENKISPYYRTKLRGLYTTAKADAEAECN
  ILRKALDKIAEIKSLLEERRIAAKIAGLYNDSEPPRKTMRRGVLMTLLQQSAMTLPLWIGKPGDKPPPLCGAIPA
  SGDYVARPGDKVAARVKAVDGDEQWILAEVVSYSHATNKYEVDDIDEEGKERHTLSRRRVIPLPQWKANPETDPE
  ALFQKEQLVLALYPQTTCFYRALIHAPPQRPQDDYSVLFEDTSYADGYSPPLNVAQRYVVACKEPKKK

• Structural information:
  • Protein Domains: (152..29-)
    (/note="SGF29-C-terminal)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00851"-)
  • Interpro: IPR037802  IPR010750  
  • Prosite: PS51518
  • PDB: 3LX7 3ME9 3MEA 3MET 3MEU 3MEV 3MEW 5C0M
  • PDBsum: 3LX7 3ME9 3MEA 3MET 3MEU 3MEV 3MEW 5C0M
  • STRING: ENSP00000316114
• Other Databases: GeneCards:  SGF29  Malacards:  SGF29

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0035064	methylated histone binding	IBA	molecular function
GO:0005671	Ada2/Gcn5/Ada3 transcription activator complex	IBA	cellular component
GO:0043966	histone H3 acetylation	IBA	biological process
GO:0000124	SAGA complex	IBA	cellular component
GO:0035064	methylated histone binding	IDA	molecular function
GO:0070461	SAGA-type complex	IDA	cellular component
GO:0035064	methylated histone binding	IDA	molecular function
GO:0016573	histone acetylation	IDA	biological process
GO:0071169	establishment of protein localization to chromatin	TAS	biological process
GO:0000124	SAGA complex	IEA	cellular component
GO:0006325	chromatin organization	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005671	Ada2/Gcn5/Ada3 transcription activator complex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0019899	enzyme binding	IEA	molecular function
GO:0047485	protein N-terminus binding	IEA	molecular function
GO:0005671	Ada2/Gcn5/Ada3 transcription activator complex	IDA	cellular component
GO:0070461	SAGA-type complex	IDA	cellular component
GO:0043966	histone H3 acetylation	IDA	biological process
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Diabetic retinopathy	PMID:21441570
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray