• Gene id: 112858

Gene Summary

• Gene Symbol: TP53RK   Gene   UCSC   Ensembl
• Aliases: BUD32, C20orf64, GAMOS4, Nori-2, Nori-2p, PRPK, TPRKB, dJ101A2
• Gene name: TP53 regulating kinase
• Alternate names: EKC/KEOPS complex subunit TP53RK, atypical serine/threonine protein kinase TP53RK, p53-related protein kinase,
• Gene location: 20q13.12 (46689443: 46684364)     Exons: 2     NC_000020.11
• OMIM: 601882

Protein Summary

• Protein general information: Q96S44  
  • Name: EKC/KEOPS complex subunit TP53RK (EC 3.6. . ) (Atypical serine/threonine protein kinase TP53RK) (Nori 2) (TP53 regulating kinase) (EC 2.7.11.1) (p53 related protein kinase)
  • Length: 253  
  • Mass: 28160
  • Tissue specificity: Highly expressed in testis. Weakly expressed in heart kidney and spleen. {ECO
• Sequence:

  MAAARATTPADGEEPAPEAEALAAARERSSRFLSGLELVKQGAEARVFRGRFQGRAAVIKHRFPKGYRHPALEAR
  LGRRRTVQEARALLRCRRAGISAPVVFFVDYASNCLYMEEIEGSVTVRDYIQSTMETEKTPQGLSNLAKTIGQVL
  ARMHDEDLIHGDLTTSNMLLKPPLEQLNIVLIDFGLSFISALPEDKGVDLYVLEKAFLSTHPNTETVFEAFLKSY
  STSSKKARPVLKKLDEVRLRGRKRSMVG

• Structural information:
  • Protein Domains: (33..25-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR022495  IPR011009  IPR000719  IPR008266  
  • Prosite: PS50011 PS00109
  • STRING: ENSP00000361186
• Other Databases: GeneCards:  TP53RK  Malacards:  TP53RK

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002039	p53 binding	IDA	molecular function
GO:0070525	tRNA threonylcarbamoyladenosine metabolic process	IBA	biological process
GO:0000408	EKC/KEOPS complex	IBA	cellular component
GO:0006468	protein phosphorylation	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0000408	EKC/KEOPS complex	IDA	cellular component
GO:0000408	EKC/KEOPS complex	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0008033	tRNA processing	IEA	biological process
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:1901796	regulation of signal transduction by p53 class mediator	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0006468	protein phosphorylation	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Galloway-Mowat syndrome	KEGG:H01722
Galloway-Mowat syndrome	KEGG:H01722
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray