• Gene id: 11283

Gene Summary

• Gene Symbol: CYP4F8   Gene   UCSC   Ensembl
• Aliases: CPF8, CYPIVF8
• Gene name: cytochrome P450 family 4 subfamily F member 8
• Alternate names: cytochrome P450 4F8, cytochrome P450, family 4, subfamily F, polypeptide 8, cytochrome P450, subfamily IVF, polypeptide 8, flavoprotein-linked monooxygenase, microsomal monooxygenase,
• Gene location: 19p13.12 (15615206: 15630638)     Exons: 13     NC_000019.10
• Gene summary(Entrez): This gene, CYP4F8, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This prot
• OMIM: 611545

Protein Summary

• Protein general information: P98187  
  • Name: Cytochrome P450 4F8 (EC 1.14.14.1) (CYPIVF8)
  • Length: 520  
  • Mass: 59995
  • Tissue specificity: Expressed in the epithelium of seminal vesicles, in renal cortex, in adult and fetal liver, in epidermis, in corneal epithelium, in sweat glands, hair follicles, epithelial linings of the ampulla of vas deferens and of the stomach and
• Sequence:

  MSLLSLSWLGLRPVAASPWLLLLVVGASWLLARILAWTYAFYHNGRRLRCFPQPRKQNWFLGHLGLVTPTEEGLR
  VLTQLVATYPQGFVRWLGPITPIINLCHPDIVRSVINTSDAITDKDIVFYKTLKPWLGDGLLLSVGDKWRHHRRL
  LTPAFHFNILKPYIKIFSKSANIMHAKWQRLAMEGSTCLDVFEHISLMTLDSLQKCIFSFDSNCQEKPSEYITAI
  MELSALVVKRNNQFFRYKDFLYFLTPCGRRFHRACRLVHDFTDAVIQERRRTLTSQGVDDFLQAKAKSKTLDFID
  VLLLSEDKNGKELSDEDIRAEADTFMFGGHDTTASGLSWVLYNLARHPEYQERCRQEVQELLKDREPKEIEWDDL
  AQLPFLTMCLKESLRLHPPIPTFARGCTQDVVLPDSRVIPKGNVCNINIFAIHHNPSVWPDPEVYDPFRFDPENA
  QKRSPMAFIPFSAGPRNCIGQKFAMAEMKVVLALTLLRFRILPDHREPRRTPEIVLRAEDGLWLRVEPLG

• Structural information:
  • Interpro: IPR001128  IPR017972  IPR002401  IPR036396  
  • Prosite: PS00086
  • STRING: ENSP00000477567
• Other Databases: GeneCards:  CYP4F8  Malacards:  CYP4F8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004497	monooxygenase activity	IBA	molecular function
GO:0008391	arachidonic acid monooxygenase activity	IBA	molecular function
GO:0042361	menaquinone catabolic process	IBA	biological process
GO:0042376	phylloquinone catabolic process	IBA	biological process
GO:0043231	intracellular membrane-bounded organelle	IBA	cellular component
GO:0050051	leukotriene-B4 20-monooxygenase activity	IBA	molecular function
GO:0055114	oxidation-reduction process	IBA	biological process
GO:0019369	arachidonic acid metabolic process	IBA	biological process
GO:0036101	leukotriene B4 catabolic process	IBA	biological process
GO:0042377	vitamin K catabolic process	IBA	biological process
GO:0005506	iron ion binding	IEA	molecular function
GO:0020037	heme binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016705	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen	IEA	molecular function
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0004497	monooxygenase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0006629	lipid metabolic process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0018685	alkane 1-monooxygenase activity	TAS	molecular function
GO:0006693	prostaglandin metabolic process	TAS	biological process
GO:0070330	aromatase activity	IEA	molecular function
GO:0006690	icosanoid metabolic process	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0031090	organelle membrane	IEA	cellular component
GO:0006631	fatty acid metabolic process	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00590	Arachidonic acid metabolism

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R