• Gene id: 112770

Gene Summary

• Gene Symbol: GLMP   Gene   UCSC   Ensembl
• Aliases: C1orf85, NCU-G1
• Gene name: glycosylated lysosomal membrane protein
• Alternate names: glycosylated lysosomal membrane protein, kidney lysosomal membrane protein, kidney predominant protein NCU-G1, lysosomal protein NCU-G1,
• Gene location: 1q22 (156295688: 156292686)     Exons: 8     NC_000001.11

Protein Summary

• Protein general information: Q8WWB7  
  • Name: Glycosylated lysosomal membrane protein (Lysosomal protein NCU G1)
  • Length: 406  
  • Mass: 43864
• Sequence:

  MRGSVECTWGWGHCAPSPLLLWTLLLFAAPFGLLGEKTRQVSLEVIPNWLGPLQNLLHIRAVGTNSTLHYVWSSL
  GPLAVVMVATNTPHSTLSVNWSLLLSPEPDGGLMVLPKDSIQFSSALVFTRLLEFDSTNVSDTAAKPLGRPYPPY
  SLADFSWNNITDSLDPATLSATFQGHPMNDPTRTFANGSLAFRVQAFSRSSRPAQPPRLLHTADTCQLEVALIGA
  SPRGNRSLFGLEVATLGQGPDCPSMQEQHSIDDEYAPAVFQLDQLLWGSLPSGFAQWRPVAYSQKPGGRESALPC
  QASPLHPALAYSLPQSPIVRAFFGSQNNFCAFNLTFGASTGPGYWDQHYLSWSMLLGVGFPPVDGLSPLVLGIMA
  VALGAPGLMLLGGGLVLLLHHKKYSEYQSIN

• Structural information:
  • Interpro: IPR029382  
  • STRING: ENSP00000354553
• Other Databases: GeneCards:  GLMP  Malacards:  GLMP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005764	lysosome	IBA	cellular component
GO:0005764	lysosome	IDA	cellular component
GO:0016021	integral component of membrane	ISS	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0000976	transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0003700	DNA-binding transcription factor activity	IMP	molecular function
GO:0005829	cytosol	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IMP	biological process
GO:0005765	lysosomal membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray