• Gene id: 112755

Gene Summary

• Gene Symbol: STX1B   Gene   UCSC   Ensembl
• Aliases: GEFSP9, STX1B1, STX1B2
• Gene name: syntaxin 1B
• Alternate names: syntaxin-1B, syntaxin-1B1, syntaxin-1B2,
• Gene location: 16p11.2 (31010637: 30989255)     Exons: 3     NC_000016.10
• Gene summary(Entrez): The protein encoded by this gene belongs to a family of proteins thought to play a role in the exocytosis of synaptic vesicles. Vesicle exocytosis releases vesicular contents and is important to various cellular functions. For instance, the secretion of t
• OMIM: 601485

Protein Summary

• Protein general information: P61266  
  • Name: Syntaxin 1B (Syntaxin 1B1) (Syntaxin 1B2)
  • Length: 288  
  • Mass: 33245
• Sequence:

  MKDRTQELRSAKDSDDEEEVVHVDRDHFMDEFFEQVEEIRGCIEKLSEDVEQVKKQHSAILAAPNPDEKTKQELE
  DLTADIKKTANKVRSKLKAIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMTEYNATQSKYRDRCKDRIQR
  QLEITGRTTTNEELEDMLESGKLAIFTDDIKMDSQMTKQALNEIETRHNEIIKLETSIRELHDMFVDMAMLVESQ
  GEMIDRIEYNVEHSVDYVERAVSDTKKAVKYQSKARRKKIMIIICCVVLGVVLASSIGGTLGL

• Structural information:
  • Protein Domains: (191..25-)
    homology (/note="t-SNARE-coiled-coil)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00202"-)
  • Interpro: IPR010989  IPR028669  IPR006012  IPR006011  IPR000727  
  • Prosite: PS00914 PS50192
  • CDD: cd00179
  • STRING: ENSP00000215095
• Other Databases: GeneCards:  STX1B  Malacards:  STX1B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:2000463	positive regulation of excitatory postsynaptic potential	ISS	biological process
GO:0019901	protein kinase binding	ISS	molecular function
GO:1905302	negative regulation of macropinocytosis	ISS	biological process
GO:0060025	regulation of synaptic activity	ISS	biological process
GO:0010807	regulation of synaptic vesicle priming	ISS	biological process
GO:0001956	positive regulation of neurotransmitter secretion	ISS	biological process
GO:0006904	vesicle docking involved in exocytosis	ISS	biological process
GO:0005886	plasma membrane	ISS	cellular component
GO:0016020	membrane	ISS	cellular component
GO:0010468	regulation of gene expression	ISS	biological process
GO:0010977	negative regulation of neuron projection development	ISS	biological process
GO:0016081	synaptic vesicle docking	ISS	biological process
GO:0048278	vesicle docking	IBA	biological process
GO:0031201	SNARE complex	IBA	cellular component
GO:0012505	endomembrane system	IBA	cellular component
GO:0006906	vesicle fusion	IBA	biological process
GO:0098967	exocytic insertion of neurotransmitter receptor to postsynaptic membrane	IBA	biological process
GO:0016021	integral component of membrane	IBA	cellular component
GO:0006887	exocytosis	IBA	biological process
GO:0006886	intracellular protein transport	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0005484	SNAP receptor activity	IBA	molecular function
GO:0000149	SNARE binding	IBA	molecular function
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0017157	regulation of exocytosis	IEA	biological process
GO:0000149	SNARE binding	IEA	molecular function
GO:0005484	SNAP receptor activity	IEA	molecular function
GO:0006886	intracellular protein transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006836	neurotransmitter transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0017157	regulation of exocytosis	IEA	biological process
GO:0042734	presynaptic membrane	IEA	cellular component
GO:0048787	presynaptic active zone membrane	IEA	cellular component
GO:0001956	positive regulation of neurotransmitter secretion	IEA	biological process
GO:0010807	regulation of synaptic vesicle priming	IEA	biological process
GO:0016079	synaptic vesicle exocytosis	IEA	biological process
GO:0030424	axon	IEA	cellular component
GO:0048791	calcium ion-regulated exocytosis of neurotransmitter	IEA	biological process
GO:0061669	spontaneous neurotransmitter secretion	IEA	biological process
GO:2000463	positive regulation of excitatory postsynaptic potential	IEA	biological process
GO:0005102	signaling receptor binding	IEA	molecular function
GO:0015031	protein transport	IEA	biological process
GO:0019904	protein domain specific binding	IEA	molecular function
GO:0072657	protein localization to membrane	IEA	biological process
GO:0098967	exocytic insertion of neurotransmitter receptor to postsynaptic membrane	IEA	biological process
GO:0005102	signaling receptor binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0006904	vesicle docking involved in exocytosis	IEA	biological process
GO:0010468	regulation of gene expression	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016081	synaptic vesicle docking	IEA	biological process
GO:0019901	protein kinase binding	IEA	molecular function
GO:0031594	neuromuscular junction	IEA	cellular component
GO:0031629	synaptic vesicle fusion to presynaptic active zone membrane	IEA	biological process
GO:0098793	presynapse	IEA	cellular component
GO:1903422	negative regulation of synaptic vesicle recycling	IEA	biological process
GO:1904050	positive regulation of spontaneous neurotransmitter secretion	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005819	spindle	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04721	Synaptic vesicle cycle
hsa04130	SNARE interactions in vesicular transport

Diseases

Associated diseases	References
Febrile seizures	KEGG:H00783
Febrile seizures	KEGG:H00783
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq