• Gene id: 112744

Gene Summary

• Gene Symbol: IL17F   Gene   UCSC   Ensembl
• Aliases: CANDF6, IL-17F, ML-1, ML1
• Gene name: interleukin 17F
• Alternate names: interleukin-17F, cytokine ML-1,
• Gene location: 6p12.2 (52245688: 52236680)     Exons: 4     NC_000006.12
• Gene summary(Entrez): The protein encoded by this gene is a cytokine that shares sequence similarity with IL17. This cytokine is expressed by activated T cells, and has been shown to stimulate the production of several other cytokines, including IL6, IL8, and CSF2/GM_CSF. This
• OMIM: 604083

Protein Summary

• Protein general information: Q96PD4  
  • Name: Interleukin 17F (IL 17F) (Cytokine ML 1)
  • Length: 163  
  • Mass: 18045
  • Tissue specificity: Expressed in activated, but not resting, CD4+ T-cells and activated monocytes.
• Sequence:

  MTVKTLHGPAMVKYLLLSILGLAFLSEAAARKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIE
  SRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTV
  GCTCVTPVIHHVQ

• Structural information:
  • Interpro: IPR029034  IPR020440  IPR010345  
  • PDB: 1JPY 3JVF 5N92 5NAN 6HGO 6PPG
  • PDBsum: 1JPY 3JVF 5N92 5NAN 6HGO 6PPG
  • STRING: ENSP00000337432
• Other Databases: GeneCards:  IL17F  Malacards:  IL17F

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005125	cytokine activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0006954	inflammatory response	IEA	biological process
GO:0005125	cytokine activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0097400	interleukin-17-mediated signaling pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:1900017	positive regulation of cytokine production involved in inflammatory response	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0005126	cytokine receptor binding	IEA	molecular function
GO:2000778	positive regulation of interleukin-6 secretion	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0045414	regulation of interleukin-8 biosynthetic process	IDA	biological process
GO:0042089	cytokine biosynthetic process	IDA	biological process
GO:0045076	regulation of interleukin-2 biosynthetic process	IDA	biological process
GO:0051216	cartilage development	IDA	biological process
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0019955	cytokine binding	IDA	molecular function
GO:0017015	regulation of transforming growth factor beta receptor signaling pathway	IDA	biological process
GO:0016525	negative regulation of angiogenesis	IDA	biological process
GO:0005125	cytokine activity	IDA	molecular function
GO:0045423	regulation of granulocyte macrophage colony-stimulating factor biosynthetic process	IDA	biological process
GO:0045408	regulation of interleukin-6 biosynthetic process	IDA	biological process
GO:0042109	lymphotoxin A biosynthetic process	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04659	Th17 cell differentiation
hsa04657	IL-17 signaling pathway
hsa05321	Inflammatory bowel disease

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881