• Gene id: 11272

Gene Summary

• Gene Symbol: PRR4   Gene   UCSC   Ensembl
• Aliases: LPRP, PROL4
• Gene name: proline rich 4
• Alternate names: proline-rich protein 4, lacrimal proline-rich protein, nasopharyngeal carcinoma-associated proline-rich protein 4, proline rich 4 (lacrimal), proline-rich polypeptide 4,
• Gene location: 12p13.2 (10849474: 10845848)     Exons: 4     NC_000012.12
• Gene summary(Entrez): This gene encodes a member of the proline-rich protein family that lacks a conserved repetitive domain. This protein may play a role in protective functions in the eye. Alternative splicing result in multiple transcript variants. Read-through transcriptio
• OMIM: 611950

Protein Summary

• Protein general information: Q16378  
  • Name: Proline rich protein 4 (Lacrimal proline rich protein) (Nasopharyngeal carcinoma associated proline rich protein 4)
  • Length: 134  
  • Mass: 15097
  • Tissue specificity: Abundantly expressed in lacrimal gland where it is found in the acinar cells but not in the intralobular ducts. Also found in the submandibular gland, the parotid and sublingual glands. {ECO
• Sequence:

  MLLVLLSVVLLALSSAQSTDNDVNYEDFTFTIPDVEDSSQRPDQGPQRPPPEGLLPRPPGDSGNQDDGPQQRPPK
  PGGHHRHPPPPPFQNQQRPPRRGHRQLSLPRFPSVSLQEASSFFQRDRPARHPQEQPLW

• Structural information:
  • Interpro: IPR026086  
  • STRING: ENSP00000228811
• Other Databases: GeneCards:  PRR4  Malacards:  PRR4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	TAS	cellular component
GO:0007601	visual perception	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0001895	retina homeostasis	HEP	biological process
GO:0005615	extracellular space	HDA	cellular component
GO:0005615	extracellular space	HDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Male factor infertility	MIK: 29961538

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
29961538	Male factor infertility			318 (128 couples presenting with OAT (MF) and 118 maternal age-matched control (no MF) subjects undergoing infertility treatment, 72 surplus cryopreserved blastocysts)	Male infertility	RNA-seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq