• Gene id: 11264

Gene Summary

• Gene Symbol: PXMP4   Gene   UCSC   Ensembl
• Aliases: PMP24
• Gene name: peroxisomal membrane protein 4
• Alternate names: peroxisomal membrane protein 4, 24 kDa peroxisomal intrinsic membrane protein, peroxisomal membrane protein 4, 24kDa,
• Gene location: 20q11.22 (33720309: 33702757)     Exons: 4     NC_000020.11
• OMIM: 616397

Protein Summary

• Protein general information: Q9Y6I8  
  • Name: Peroxisomal membrane protein 4 (24 kDa peroxisomal intrinsic membrane protein)
  • Length: 212  
  • Mass: 24264
  • Tissue specificity: Expressed in normal prostate epithelial cells, and androgen-sensitive prostate adenocarcinoma cells. Not expressed in androgen-insensitive prostate adenocarcinoma cells. {ECO
• Sequence:

  MAAPPQLRALLVVVNALLRKRRYHAALAVLKGFRNGAVYGAKIRAPHALVMTFLFRNGSLQEKLWAILQATYIHS
  WNLARFVFTYKGLRALQSYIQGKTYPAHAFLAAFLGGILVFGENNNINSQINMYLLSRVLFALSRLAVEKGYIPE
  PRWDPFPLLTAVVWGLVLWLFEYHRSTLQPSLQSSMTYLYEDSNVWHDISDFLVYNKSRPSN

• Structural information:
  • Interpro: IPR019531  
  • STRING: ENSP00000386385
• Other Databases: GeneCards:  PXMP4  Malacards:  PXMP4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005778	peroxisomal membrane	IBA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005777	peroxisome	IEA	cellular component
GO:0005777	peroxisome	IDA	cellular component
GO:0005778	peroxisomal membrane	IEA	cellular component
GO:0005778	peroxisomal membrane	IEA	cellular component
GO:0005778	peroxisomal membrane	IDA	cellular component
GO:0008150	biological_process	ND	biological process
GO:0005778	peroxisomal membrane	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04146	Peroxisome

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)