• Gene id: 11261

Gene Summary

• Gene Symbol: CHP1   Gene   UCSC   Ensembl
• Aliases: CHP, SLC9A1BP, SPAX9, Sid470p, p22, p24
• Gene name: calcineurin like EF-hand protein 1
• Alternate names: calcineurin B homologous protein 1, EF-hand calcium-binding domain-containing protein p22, SLC9A1 binding protein, calcineurin B homolog, calcineurin B-like protein, calcineurin homologous protein, calcium binding protein P22, calcium-binding protein CHP, calcium,
• Gene location: 15q15.1 (41231155: 41281886)     Exons: 8     NC_000015.10
• Gene summary(Entrez): This gene encodes a phosphoprotein that binds to the Na+/H+ exchanger NHE1. This protein serves as an essential cofactor which supports the physiological activity of NHE family members and may play a role in the mitogenic regulation of NHE1. The protein s
• OMIM: 606988

Protein Summary

• Protein general information: Q99653  
  • Name: Calcineurin B homologous protein 1 (Calcineurin B like protein) (Calcium binding protein CHP) (Calcium binding protein p22) (EF hand calcium binding domain containing protein p22)
  • Length: 195  
  • Mass: 22456
  • Tissue specificity: Ubiquitously expressed. Has been found in fetal eye, lung, liver, muscle, heart, kidney, thymus and spleen. {ECO
• Sequence:

  MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFPEGE
  DQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDEKISRDELLQVLRMMVGVNISDE
  QLGSIADRTIQEADQDGDSAISFTEFVKVLEKVDVEQKMSIRFLH

• Structural information:
  • Protein Domains: (26..6-)
    (/note="EF-hand-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448-)
    (66..10-)
    (/note="EF-hand-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448-)
    (110..14-)
    (/note="EF-hand-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00-)
  • Interpro: IPR011992  IPR002048  
  • Prosite: PS50222
  • CDD: cd00051
  • PDB: 2000 0000 0000 0000 0397 6924 9677 312
  • PDBsum: 2000 0000 0000 0000 0397 6924 9677 312
  • STRING: ENSP00000335632
• Other Databases: GeneCards:  CHP1  Malacards:  CHP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042308	negative regulation of protein import into nucleus	IDA	biological process
GO:0005509	calcium ion binding	IDA	molecular function
GO:0070885	negative regulation of calcineurin-NFAT signaling cascade	IDA	biological process
GO:0051453	regulation of intracellular pH	IDA	biological process
GO:0051453	regulation of intracellular pH	IDA	biological process
GO:0048306	calcium-dependent protein binding	IDA	molecular function
GO:0032417	positive regulation of sodium:proton antiporter activity	IDA	biological process
GO:0032417	positive regulation of sodium:proton antiporter activity	IDA	biological process
GO:0032088	negative regulation of NF-kappaB transcription factor activity	IDA	biological process
GO:0010923	negative regulation of phosphatase activity	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0061024	membrane organization	ISS	biological process
GO:0060050	positive regulation of protein glycosylation	ISS	biological process
GO:0051222	positive regulation of protein transport	ISS	biological process
GO:0050821	protein stabilization	ISS	biological process
GO:0050821	protein stabilization	ISS	biological process
GO:0031953	negative regulation of protein autophosphorylation	ISS	biological process
GO:0031397	negative regulation of protein ubiquitination	ISS	biological process
GO:0031122	cytoplasmic microtubule organization	ISS	biological process
GO:0015630	microtubule cytoskeleton	ISS	cellular component
GO:0008017	microtubule binding	ISS	molecular function
GO:0006611	protein export from nucleus	ISS	biological process
GO:0005783	endoplasmic reticulum	ISS	cellular component
GO:0001933	negative regulation of protein phosphorylation	ISS	biological process
GO:0000139	Golgi membrane	ISS	cellular component
GO:0005886	plasma membrane	IMP	cellular component
GO:0090314	positive regulation of protein targeting to membrane	ISS	biological process
GO:0071468	cellular response to acidic pH	ISS	biological process
GO:0032417	positive regulation of sodium:proton antiporter activity	ISS	biological process
GO:0019900	kinase binding	ISS	molecular function
GO:0006469	negative regulation of protein kinase activity	ISS	biological process
GO:0005737	cytoplasm	ISS	cellular component
GO:0005634	nucleus	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001578	microtubule bundle formation	ISS	biological process
GO:0005509	calcium ion binding	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0015031	protein transport	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0004860	protein kinase inhibitor activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0015459	potassium channel regulator activity	TAS	molecular function
GO:0006813	potassium ion transport	TAS	biological process
GO:0007264	small GTPase mediated signal transduction	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0030214	hyaluronan catabolic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0061025	membrane fusion	IEA	biological process
GO:0061024	membrane organization	IEA	biological process
GO:0060050	positive regulation of protein glycosylation	IEA	biological process
GO:0051259	protein complex oligomerization	IEA	biological process
GO:0051222	positive regulation of protein transport	IEA	biological process
GO:0050821	protein stabilization	IEA	biological process
GO:0031953	negative regulation of protein autophosphorylation	IEA	biological process
GO:0031397	negative regulation of protein ubiquitination	IEA	biological process
GO:0031122	cytoplasmic microtubule organization	IEA	biological process
GO:0017156	calcium-ion regulated exocytosis	IEA	biological process
GO:0015630	microtubule cytoskeleton	IEA	cellular component
GO:0008017	microtubule binding	IEA	molecular function
GO:0006611	protein export from nucleus	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005509	calcium ion binding	IEA	molecular function
GO:0001933	negative regulation of protein phosphorylation	IEA	biological process
GO:0000139	Golgi membrane	IEA	cellular component
GO:0030133	transport vesicle	IEA	cellular component
GO:0022406	membrane docking	IEA	biological process
GO:0019900	kinase binding	IEA	molecular function
GO:0006469	negative regulation of protein kinase activity	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0001578	microtubule bundle formation	IEA	biological process
GO:0012505	endomembrane system	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005793	endoplasmic reticulum-Golgi intermediate compartment	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:1901214	regulation of neuron death	IMP	biological process
GO:0005925	focal adhesion	HDA	cellular component
GO:0030133	transport vesicle	ISS	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0022406	membrane docking	ISS	biological process
GO:0061025	membrane fusion	ISS	biological process

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray