• Gene id: 112609

Gene Summary

• Gene Symbol: MRAP2   Gene   UCSC   Ensembl
• Aliases: C6orf117, bA51G5.2
• Gene name: melanocortin 2 receptor accessory protein 2
• Alternate names: melanocortin-2 receptor accessory protein 2, MC2R accessory protein 2,
• Gene location: 6q14.2 (2354476: 2251769)     Exons: 15     NC_000007.14
• Gene summary(Entrez): This gene encodes a protein that modulates melanocortin receptor signaling. The encoded protein has been shown to interact with all known melanocortin receptors and may regulate both receptor trafficking and activation in response to ligands. Mice lacking
• OMIM: 615410

Protein Summary

• Protein general information: Q96G30  
  • Name: Melanocortin 2 receptor accessory protein 2 (MC2R accessory protein 2)
  • Length: 205  
  • Mass: 23548
  • Tissue specificity: Expressed in the adrenal gland and brain. Not expressed in other tissues. {ECO
• Sequence:

  MSAQRLISNRTSQQSASNSDYTWEYEYYEIGPVSFEGLKAHKYSIVIGFWVGLAVFVIFMFFVLTLLTKTGAPHQ
  DNAESSEKRFRMNSFVSDFGRPLEPDKVFSRQGNEESRSLFHCYINEVERLDRAKACHQTTALDSDVQLQEAIRS
  SGQPEEELNRLMKFDIPNFVNTDQNYFGEDDLLISEPPIVLETKPLSQTSHKDLD

• Structural information:
  • Interpro: IPR028111  
  • DIP: 48793
  • STRING: ENSP00000257776
• Other Databases: GeneCards:  MRAP2  Malacards:  MRAP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0030545	receptor regulator activity	IBA	molecular function
GO:0031781	type 3 melanocortin receptor binding	IBA	molecular function
GO:0031782	type 4 melanocortin receptor binding	IBA	molecular function
GO:0031783	type 5 melanocortin receptor binding	IBA	molecular function
GO:0072659	protein localization to plasma membrane	IBA	biological process
GO:0106070	regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0031780	corticotropin hormone receptor binding	IBA	molecular function
GO:0070996	type 1 melanocortin receptor binding	IBA	molecular function
GO:0097009	energy homeostasis	ISS	biological process
GO:0007631	feeding behavior	ISS	biological process
GO:0006112	energy reserve metabolic process	ISS	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031782	type 4 melanocortin receptor binding	IEA	molecular function
GO:0030545	receptor regulator activity	IEA	molecular function
GO:0097009	energy homeostasis	IEA	biological process
GO:0007631	feeding behavior	IEA	biological process
GO:0006112	energy reserve metabolic process	IEA	biological process
GO:0031781	type 3 melanocortin receptor binding	IPI	molecular function
GO:0031782	type 4 melanocortin receptor binding	IPI	molecular function
GO:0031783	type 5 melanocortin receptor binding	IPI	molecular function
GO:0031780	corticotropin hormone receptor binding	IPI	molecular function
GO:0070996	type 1 melanocortin receptor binding	IPI	molecular function
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0106071	positive regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	biological process
GO:0072659	protein localization to plasma membrane	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0106072	negative regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	biological process
GO:1903077	negative regulation of protein localization to plasma membrane	IDA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Genetic obesity	KEGG:H02106
Genetic obesity	KEGG:H02106
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881