• Gene id: 11258

Gene Summary

• Gene Symbol: DCTN3   Gene   UCSC   Ensembl
• Aliases: DCTN-22, DCTN22
• Gene name: dynactin subunit 3
• Alternate names: dynactin subunit 3, dynactin 3 (p22), dynactin complex subunit 22 kDa subunit, dynactin light chain,
• Gene location: 9p13.3 (34620522: 34613544)     Exons: 7     NC_000009.12
• Gene summary(Entrez): This gene encodes the smallest subunit of dynactin, a macromolecular complex consisting of 10 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions,
• OMIM: 607387

Protein Summary

• Protein general information: O75935  
  • Name: Dynactin subunit 3 (Dynactin complex subunit 22 kDa subunit) (p22)
  • Length: 186  
  • Mass: 21119
  • Tissue specificity: Ubiquitously expressed. Highly expressed in muscle and pancreas and detected at lower levels in brain. {ECO
• Sequence:

  MAGLTDLQRLQARVEELERWVYGPGGARGSRKVADGLVKVQVALGNISSKRERVKILYKKIEDLIKYLDPEYIDR
  IAIPDASKLQFILAEEQFILSQVALLEQVNALVPMLDSAHIKAVPEHAARLQRLAQIHIQQQDQCVEITEESKAL
  LEEYNKTTMLLSKQFVQWDELLCQLEAATQVKPAEE

• Structural information:
  • Interpro: IPR009991  
  • STRING: ENSP00000259632
• Other Databases: GeneCards:  DCTN3  Malacards:  DCTN3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0061640	cytoskeleton-dependent cytokinesis	IBA	biological process
GO:0005869	dynactin complex	IBA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005869	dynactin complex	IEA	cellular component
GO:0061640	cytoskeleton-dependent cytokinesis	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0000776	kinetochore	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005198	structural molecule activity	TAS	molecular function
GO:0005869	dynactin complex	TAS	cellular component
GO:0000278	mitotic cell cycle	TAS	biological process
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	TAS	biological process
GO:0019886	antigen processing and presentation of exogenous peptide antigen via MHC class II	TAS	biological process
GO:0000086	G2/M transition of mitotic cell cycle	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0010389	regulation of G2/M transition of mitotic cell cycle	TAS	biological process
GO:0097711	ciliary basal body-plasma membrane docking	TAS	biological process
GO:0005875	microtubule associated complex	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0005869	dynactin complex	IEA	cellular component
GO:0007017	microtubule-based process	IEA	biological process
GO:0005869	dynactin complex	IEA	cellular component
GO:0032154	cleavage furrow	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0000777	condensed chromosome kinetochore	IEA	cellular component
GO:0005819	spindle	IEA	cellular component
GO:0030496	midbody	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0061640	cytoskeleton-dependent cytokinesis	IDA	biological process
GO:0005869	dynactin complex	IPI	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05016	Huntington disease

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881